Actinokineospora sp. UTMC 2448: Actkin_01148
Help
Entry
Actkin_01148 CDS
T08397
Symbol
clpS
Name
(GenBank) ATP-dependent Clp protease adapter protein ClpS
KO
K06891
ATP-dependent Clp protease adaptor protein ClpS
Organism
actu
Actinokineospora sp. UTMC 2448
Brite
KEGG Orthology (KO) [BR:
actu00001
]
09190 Not Included in Pathway or Brite
09192 Unclassified: genetic information processing
99975 Protein processing
Actkin_01148 (clpS)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ClpS
Motif
Other DBs
NCBI-ProteinID:
UVS77438
LinkDB
All DBs
Position
1212306..1212605
Genome browser
AA seq
99 aa
AA seq
DB search
MTAPVDMEQTQSSPVGSEVVSEDRPWQTVVWNDPVNLMSYVTYVFQKLFGYSRDKATKLM
LDVHHEGKAVVSSGTKEKVEGDVARLHAAGLWATMEHAS
NT seq
300 nt
NT seq
+upstream
nt +downstream
nt
atgaccgcgcccgtcgacatggagcagacgcagagcagtcccgtcggttccgaggtggtg
tccgaggacagaccgtggcagacggtcgtctggaacgacccggtcaacctcatgtcgtac
gtgacctacgtcttccagaagctgttcggctacagccgggacaaggcgaccaagctcatg
ctcgacgtgcaccacgagggcaaggccgtggtgtcgtcggggaccaaggagaaggtcgag
ggcgacgtggcccgcctccacgccgccggtctctgggcgacgatggaacacgcctcgtga
DBGET
integrated database retrieval system