Actinomyces sp. 432: CWT12_08710 Help Entry CWT12_08710       CDS       T06433                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism actz  Actinomyces sp. 432 Brite KEGG Orthology (KO) [BR:actz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:actz03032]     CWT12_08710    03036 Chromosome and associated proteins [BR:actz03036]     CWT12_08710    03400 DNA repair and recombination proteins [BR:actz03400]     CWT12_08710 DNA replication proteins [BR:actz03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CWT12_08710 Chromosome and associated proteins [BR:actz03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CWT12_08710 DNA repair and recombination proteins [BR:actz03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CWT12_08710 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF7342 DSBA HU-DNA_bdg DUF2267 Motif Other DBs NCBI-ProteinID:  QHO91374 UniProt:  A0A7L5ATT0 LinkDB All DBs Position complement(2090497..2090781) Genome browser AA seq 94 aa AA seqDB search MSINRTELIAAIAEKAGLTKTDADAFLGAFQDVLVENVAKGEAVKITGLMGVERVERAAR TGRNPRTGEEIQIPAGHGVKLTAGSALKKAASGK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgtccatcaaccgcaccgagctcattgccgccatcgccgagaaggccggcctgaccaag accgacgccgacgccttcctcggcgccttccaggacgtcctggtggagaacgtcgccaag ggagaggccgtcaagatcaccggtctgatgggtgttgagcgcgtcgagcgcgccgctcgt accggccgcaacccccgcaccggtgaggagatccagattcccgccggccacggtgtgaag ctcaccgccggctccgccctgaagaaggccgcctccggcaagtga

DBGET integrated database retrieval system