Acidithiobacillus caldus SM-1: Atc_0620
Help
Entry
Atc_0620 CDS
T01581
Name
(GenBank) LSU ribosomal protein L18p (L5e)
KO
K02881
large subunit ribosomal protein L18
Organism
acu
Acidithiobacillus caldus SM-1
Pathway
acu03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
acu00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
Atc_0620
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
acu03011
]
Atc_0620
Ribosome [BR:
acu03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
Atc_0620
Bacteria
Atc_0620
Archaea
Atc_0620
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Motif
Other DBs
NCBI-ProteinID:
AEK57269
UniProt:
F9ZM58
LinkDB
All DBs
Position
622131..622487
Genome browser
AA seq
118 aa
AA seq
DB search
MKDKNIARLRRARKTRIRIAGQGKPRLCVFRSGRHIYAQIIDDAKGQVLTQASSLEKEAR
SAHGLGNDVAAAAAIGERVAQKALAIGIKEVAFDRSGYRYHGRVKALAEAAREGGLSF
NT seq
357 nt
NT seq
+upstream
nt +downstream
nt
atgaaagacaagaatatcgcacgcttgcggcgagcgcggaaaacccggatccgcatagcg
ggtcagggaaagccgaggttgtgtgtgttccgctcgggtcgacacatctacgcgcagatc
atcgatgacgccaaaggtcaagtgctgacgcaagcttccagtcttgagaaggaagcgcgg
agcgcgcacgggctcggtaacgatgtcgcagcagccgcggccattggtgagcgagtagcg
cagaaggcgctggcgatcgggatcaaggaagtggccttcgaccggagtggttaccgttac
cacggtcgtgtgaaggcgctggcggaggccgcgcgtgaaggcggtctgtctttctga
DBGET
integrated database retrieval system