Acidithiobacillus caldus SM-1: Atc_1017 Help Entry Atc_1017          CDS       T01581                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism acu  Acidithiobacillus caldus SM-1 Pathway acu01100   Metabolic pathways acu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Atc_1017    00074 Mycolic acid biosynthesis     Atc_1017   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Atc_1017 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH DUF1896 Motif Other DBs NCBI-ProteinID:  AEK57666 UniProt:  F9ZL80 LinkDB All DBs Position 1002934..1003182 Genome browser AA seq 82 aa AA seqDB search MDDVAARVKKVVVEQLGVNEDEVTNEASFVDDLGADSLDTVELVMALEEEFDCEIPDEEA EKIATVQQAIDYISAHLPKQDA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggatgatgtggcagcacgtgtgaagaaagtggtcgtggaacagctgggagtcaacgag gatgaggtcaccaacgaggcgtccttcgtggacgatctgggtgcagattccctggacacc gtggaactggtgatggccctggaagaagagttcgactgtgagattccggacgaagaagct gaaaagattgccaccgtgcagcaggccattgattacatcagcgcgcatttgcccaagcag gatgcctga

DBGET integrated database retrieval system