Agrobacterium cucumeris: KZ699_04110 Help Entry KZ699_04110       CDS       T09081                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism acuc  Agrobacterium cucumeris Pathway acuc01100   Metabolic pathways acuc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acuc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KZ699_04110    00074 Mycolic acid biosynthesis     KZ699_04110   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KZ699_04110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Delta_lysin Motif Other DBs NCBI-ProteinID:  WHO08991 LinkDB All DBs Position 1:842145..842381 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDADKVVEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtaaagaaaattgtaattgatcatcttggcgttgacgcc gacaaggttgtcgaaggcgccagcttcattgacgatctgggcgctgattcgctcgacacc gttgaactggtcatggctttcgaagaagaattcggcgttgaaattcccgacgacgcagcg gactcgatcctgaccgttggcgacgccgtcaagttcatcgagaaggcccaggcctga

DBGET integrated database retrieval system