Athene cunicularia (burrowing owl): 113479572 Help Entry 113479572         CDS       T05777                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism acun  Athene cunicularia (burrowing owl) Pathway acun04060   Cytokine-cytokine receptor interaction acun04218   Cellular senescence acun04620   Toll-like receptor signaling pathway acun04621   NOD-like receptor signaling pathway acun04622   RIG-I-like receptor signaling pathway acun05132   Salmonella infection acun05164   Influenza A Brite KEGG Orthology (KO) [BR:acun00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     113479572  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     113479572  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     113479572    04621 NOD-like receptor signaling pathway     113479572    04622 RIG-I-like receptor signaling pathway     113479572  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     113479572   09171 Infectious disease: bacterial    05132 Salmonella infection     113479572  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:acun04052]     113479572    00536 Glycosaminoglycan binding proteins [BR:acun00536]     113479572 Cytokines and neuropeptides [BR:acun04052]  Cytokines   Chemokines    113479572 Glycosaminoglycan binding proteins [BR:acun00536]  Heparan sulfate / Heparin   Chemokines    113479572 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  113479572 NCBI-ProteinID:  XP_026703528 LinkDB All DBs Position 4 AA seq 94 aa AA seqDB search MGKAVAAVLTLLLISAVGTKGKALPRSAIELRCQCVGTHSKFIHPKFIHNVNLIPSGPHC KNVEVIATLTDGREVCLEPTAPWVKLIIKAILDK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgggcaaggccgtggcagctgtcctgactcttctcctgatctcagcggttggaacaaaa ggcaaggccctgccacgttcagcgattgaactccggtgccagtgtgtaggcacccactcc aagttcattcatcccaaattcattcacaacgtgaacctcatccccagtggacctcactgc aagaacgttgaagtcatagctaccctgacagacggcagagaagtgtgcctggagcccact gctccctgggtgaagctgatcatcaaggcaattctggacaagtga

DBGET integrated database retrieval system