Athene cunicularia (burrowing owl): 113479820 Help Entry 113479820         CDS       T05777                                  Name (RefSeq) histone H2A.Z   KO K11251   histone H2A Organism acun  Athene cunicularia (burrowing owl) Pathway acun03082   ATP-dependent chromatin remodeling acun04217   Necroptosis Brite KEGG Orthology (KO) [BR:acun00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     113479820  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     113479820  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:acun03036]     113479820   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acun04147]     113479820 Chromosome and associated proteins [BR:acun03036]  Eukaryotic type   Nucleosome assembly factors    Histones     113479820 Exosome [BR:acun04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113479820 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  113479820 NCBI-ProteinID:  XP_026703944 LinkDB All DBs Position 4 AA seq 128 aa AA seqDB search MAGGKAGKDSGKTKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTV NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggcggcaaagctgggaaggactctggaaagaccaagaccaaagcagtgtcccgt tctcagcgggctggattgcagtttcctgttggccgcatccacaggcacctgaagtctagg actaccagccatgggcgtgtaggagccacagctgctgtgtatagcgctgcaatcctggag tacttgacagctgaggtacttgagctggcaggaaatgcatccaaggacttgaaggtgaaa cgtatcactccccgtcacttgcagcttgcaattagaggagatgaagaattggattctctt attaaggcaacaattgctggtggtggtgtaataccgcacatccacaagtctctcattggc aagaaaggacaacagaaaactgtctaa

DBGET integrated database retrieval system