Athene cunicularia (burrowing owl): 113480061 Help Entry 113480061         CDS       T05777                                  Symbol RGCC Name (RefSeq) regulator of cell cycle RGCC   KO K26108   regulator of cell cycle RGCC Organism acun  Athene cunicularia (burrowing owl) Pathway acun04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:acun00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     113480061 (RGCC) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RGCC Motif Other DBs NCBI-GeneID:  113480061 NCBI-ProteinID:  XP_026704420 LinkDB All DBs Position 4 AA seq 101 aa AA seqDB search MADELSDLLREFDEVMEDFDRGPACQYEQHLEELKKKSGHSVYDSGIDELESTSTSPGSS LNSSEEDLNTPANAYPSKAKLGDTQELEEFIADLDKVLEEM NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggctgatgagctcagtgacctgctgcgggagtttgatgaggtgatggaggactttgac agaggccctgcgtgccaatacgagcagcacctggaggagctgaagaagaaatcgggacat agcgtgtatgatagcggcattgatgagctggagagtaccagcacgtccccaggaagcagt ctcaactccagtgaggaggacctcaacacccctgccaatgcttacccctccaaagcaaag cttggtgacacgcaggagctggaggagttcattgcagatctggataaagtattggaggag atgtga

DBGET integrated database retrieval system