Athene cunicularia (burrowing owl): 113481600 Help Entry 113481600         CDS       T05777                                  Symbol ELOB Name (RefSeq) LOW QUALITY PROTEIN: elongin-B   KO K03873   elongin-B Organism acun  Athene cunicularia (burrowing owl) Pathway acun04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:acun00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     113481600 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:acun04121]     113481600 (ELOB)    03400 DNA repair and recombination proteins [BR:acun03400]     113481600 (ELOB) Ubiquitin system [BR:acun04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      113481600 (ELOB)    Cul5 complex      113481600 (ELOB) DNA repair and recombination proteins [BR:acun03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      113481600 (ELOB) SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD McyA_C Motif Other DBs NCBI-GeneID:  113481600 NCBI-ProteinID:  XP_026707184 LinkDB All DBs Position 6 AA seq 119 aa AA seqDB search MYVYLMICCHKTRFIEAKETTTVHELKKVMEGILKRPLEEQRLYKDNQLLDDXITGLCXT GLSSRSCCPHVPATVGLALFRPSNGTFEPLHIDPFSSTPELPDAMKSQESGNSSSKALH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgtatgtctacctgatgatttgctgccacaagacaaggttcattgaggccaaagagaca acaactgtgcatgagttgaaaaaggtgatggagggaatactgaagaggccactggaggag cagaggctttacaaagataaccagctactggatgatnngatcacaggactctgctagact ggcttaagcagccgaagctgttgtcctcatgttcctgccacagtgggcttggctttattc agacctagcaatggcacctttgaaccattgcatattgaccccttctcaagcaccccagag ctacctgatgctatgaagtcacaggagtctggtaacagctctagtaaagctttgcattaa

DBGET integrated database retrieval system