Athene cunicularia (burrowing owl): 113481794 Help Entry 113481794         CDS       T05777                                  Symbol NPS Name (RefSeq) neuropeptide S   KO K25691   neuropeptide S Organism acun  Athene cunicularia (burrowing owl) Pathway acun04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:acun00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     113481794 (NPS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:acun04052]     113481794 (NPS) Cytokines and neuropeptides [BR:acun04052]  Neuropeptides   GPCR binding    113481794 (NPS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Neuropeptide_S Motif Other DBs NCBI-GeneID:  113481794 NCBI-ProteinID:  XP_026707521 LinkDB All DBs Position 6 AA seq 97 aa AA seqDB search SLCRLNFAFILWISMIFMCSGYPVVPSMSSNPFYLNCQLYGKSDYCLVLLNNCLAKVGRN EELAFLKPYLEMPFSKRSFRNGVGSGIKKTSFRRAKS NT seq 294 nt NT seq  +upstreamnt  +downstreamnt agtctatgcaggttaaactttgctttcattctttggatctcaatgatattcatgtgctcg ggttacccagttgtcccttccatgagcagcaatcctttttatttgaattgccagctgtat gggaaatctgattactgcctcgtcctgctgaataactgcttagccaaggtgggcaggaat gaagaactggcttttttaaagccttacctggagatgcctttcagtaaaaggtccttccgc aacggagttggatcgggaattaaaaaaacttcctttcgaagagcaaagtcataa

DBGET integrated database retrieval system