Athene cunicularia (burrowing owl): 113483406 Help Entry 113483406         CDS       T05777                                  Symbol PFN2 Name (RefSeq) profilin-2   KO K05759   profilin Organism acun  Athene cunicularia (burrowing owl) Pathway acun04810   Regulation of actin cytoskeleton acun05132   Salmonella infection Brite KEGG Orthology (KO) [BR:acun00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     113483406 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113483406 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:acun04131]     113483406 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:acun04812]     113483406 (PFN2)    04147 Exosome [BR:acun04147]     113483406 (PFN2) Membrane trafficking [BR:acun04131]  Others   Actin-binding proteins    Others     113483406 (PFN2) Cytoskeleton proteins [BR:acun04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      113483406 (PFN2) Exosome [BR:acun04147]  Exosomal proteins   Proteins found in most exosomes    113483406 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  113483406 NCBI-ProteinID:  XP_026710741 LinkDB All DBs Position 9 AA seq 98 aa AA seqDB search MRPVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVA VGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgcggccggtagaaatagatatgattgtaggaaaagaccgagagggtttcttcaccaat ggtctgacccttggtgcaaagaagtgctctgtgatcagagatagcctgtatgttgacggc gactgcacaatggacatcaggacaaagagtcaaggtggtgagccaacatacaatgttgct gtaggcagagctggccgagtcttggtctttgtaatgggcaaagaaggggtccatggaggc ggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttctag

DBGET integrated database retrieval system