Athene cunicularia (burrowing owl): 113483448 Help Entry 113483448         CDS       T05777                                  Symbol CLDN1 Name (RefSeq) claudin-1   KO K06087   claudin Organism acun  Athene cunicularia (burrowing owl) Pathway acun03272   Virion - Hepatitis viruses acun04382   Cornified envelope formation acun04514   Cell adhesion molecule (CAM) interaction acun04530   Tight junction Brite KEGG Orthology (KO) [BR:acun00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     113483448 (CLDN1)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     113483448 (CLDN1)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     113483448 (CLDN1)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     113483448 (CLDN1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:acun03037]     113483448 (CLDN1)    04147 Exosome [BR:acun04147]     113483448 (CLDN1) Cilium and associated proteins [BR:acun03037]  Other cilia and associated proteins   Stereociliary proteins    113483448 (CLDN1) Exosome [BR:acun04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    113483448 (CLDN1)   Exosomal proteins of colorectal cancer cells    113483448 (CLDN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Voltage_CLC CD20 OppC_N HlyIII DUF6232 DUF4134 DUF998 Cytochrom_B_C Motif Other DBs NCBI-GeneID:  113483448 NCBI-ProteinID:  XP_026710787 LinkDB All DBs Position 9 AA seq 149 aa AA seqDB search MGQSVVKKLQRTGSLQATRALMVAAILLGLVGVFVAVTGMKCMKCMEDDQVKKMRMAVFG GVIFIIAGLAALVATSWYGNRVARAFYDPFTPVNTRFEFGSALFIGWAAASLAILGGAFL CCSCPRRETSYPPTRGYPKNAPSTGKDYV NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggggcaaagtgtagtaaagaagctgcagaggacaggcagtctgcaggccactcgggct ttgatggtggctgcaatactactgggccttgttggtgtatttgttgctgtgactggcatg aaatgcatgaagtgcatggaagatgaccaggtgaagaagatgcggatggctgtctttggt ggggtgatcttcatcattgcaggtttggcagcactggtggccacatcgtggtatggcaac agagtggctcgggccttttacgaccctttcacccctgtcaacaccaggtttgagtttgga tcagctctcttcataggctgggcagctgcttctctggccatactggggggagccttcctc tgctgctcctgtccacggagagaaacttcatatccacccacccgaggctatccaaaaaat gccccctccacagggaaggattatgtataa

DBGET integrated database retrieval system