Athene cunicularia (burrowing owl): 113484813 Help Entry 113484813         CDS       T05777                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism acun  Athene cunicularia (burrowing owl) Pathway acun04137   Mitophagy - animal acun04140   Autophagy - animal acun04144   Endocytosis acun04145   Phagosome acun04148   Efferocytosis acun05132   Salmonella infection Brite KEGG Orthology (KO) [BR:acun00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113484813 (RAB7A)    04145 Phagosome     113484813 (RAB7A)    04140 Autophagy - animal     113484813 (RAB7A)    04137 Mitophagy - animal     113484813 (RAB7A)    04148 Efferocytosis     113484813 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113484813 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:acun04131]     113484813 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acun04147]     113484813 (RAB7A)    04031 GTP-binding proteins [BR:acun04031]     113484813 (RAB7A) Membrane trafficking [BR:acun04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     113484813 (RAB7A) Exosome [BR:acun04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113484813 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    113484813 (RAB7A)   Exosomal proteins of colorectal cancer cells    113484813 (RAB7A)   Exosomal proteins of bladder cancer cells    113484813 (RAB7A) GTP-binding proteins [BR:acun04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     113484813 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_24 AAA_16 G-alpha AAA_5 ATPase_2 AAA_14 NACHT NB-ARC ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  113484813 NCBI-ProteinID:  XP_026713252 UniProt:  A0A663M7M2 LinkDB All DBs Position 12 AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRVKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttctaggaagaaagtgttactgaaagtcatcatccttggagactctggggtggga aagacatcgctgatgaaccagtatgtgaacaagaaattcagtaaccagtacaaggctacg ataggcgcagacttcctgacaaaagaggtcatggtggatgacaggctagtgacaatgcag atatgggatacagcaggacaagaacgatttcagtctctgggagttgccttctacagggga gcagactgctgtgtgctggtgtttgatgtcacagcccccaacacattcaaaaccctagac agctggagggacgaattcctcattcaggccagtccaagggatcctgagaactttcctttt gttgtgctgggaaacaagattgacctagaaaacagacaagtcaccacaaaacgggcacaa gcctggtgctacagtaaaaacaacatcccctactttgaaaccagtgccaaggaggccatt aatgtggaacaagctttccagacgattgcacgaaatgcacttaaacaggaaaccgaagtg gagctttacaatgaattccctgaacctatcaaactagacaagaatgaccgagtgaaggct tctgcggagagctgcagctgctga

DBGET integrated database retrieval system