Athene cunicularia (burrowing owl): 113485019 Help Entry 113485019         CDS       T05777                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism acun  Athene cunicularia (burrowing owl) Pathway acun04081   Hormone signaling acun04144   Endocytosis acun04150   mTOR signaling pathway acun04270   Vascular smooth muscle contraction acun04310   Wnt signaling pathway acun04350   TGF-beta signaling pathway acun04510   Focal adhesion acun04520   Adherens junction acun04530   Tight junction acun04621   NOD-like receptor signaling pathway acun04625   C-type lectin receptor signaling pathway acun04810   Regulation of actin cytoskeleton acun05100   Bacterial invasion of epithelial cells acun05132   Salmonella infection Brite KEGG Orthology (KO) [BR:acun00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     113485019 (RHOA)    04350 TGF-beta signaling pathway     113485019 (RHOA)    04150 mTOR signaling pathway     113485019 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     113485019 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113485019 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     113485019 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:acun04131]     113485019 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acun04147]     113485019 (RHOA)    04031 GTP-binding proteins [BR:acun04031]     113485019 (RHOA) Membrane trafficking [BR:acun04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     113485019 (RHOA) Exosome [BR:acun04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113485019 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    113485019 (RHOA)   Exosomal proteins of colorectal cancer cells    113485019 (RHOA)   Exosomal proteins of bladder cancer cells    113485019 (RHOA) GTP-binding proteins [BR:acun04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     113485019 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  113485019 NCBI-ProteinID:  XP_026713620 LinkDB All DBs Position 12 AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcgaaaaaagctggttatagtgggtgatggtgcctgtggaaagacctgt ctgctgattgtatttagcaaagaccagttccctgaagtgtatgttcccaccgtctttgaa aactatgtagcagatatcgaagtggatggaaagcaggttgagttggctttgtgggataca gcaggacaagaagactatgatcgacttagaccgctttcttatccagatactgatgttata cttatgtgtttttcaattgatagtcctgatagtttagaaaacatcccagagaaatggacc ccggaggtgaagcatttctgccccaacgtgcctatcatcttggtaggaaacaagaaggac ctgaggaacgacgagcacacaagacgagagctggccaaaatgaagcaggagcctgtcaaa cccgaagaaggaagagatatggcaaaccgcattggtgcattcgggtatatggagtgttcg gcaaagaccaaagacggtgtgagggaggtttttgaaatggccactagagctgctttgcaa gcccggcgtggcaagaaaaagtccgggtgccttctcttataa

DBGET integrated database retrieval system