Athene cunicularia (burrowing owl): 113487944 Help Entry 113487944         CDS       T05777                                  Symbol CLDN19 Name (RefSeq) claudin-19   KO K06087   claudin Organism acun  Athene cunicularia (burrowing owl) Pathway acun03272   Virion - Hepatitis viruses acun04382   Cornified envelope formation acun04514   Cell adhesion molecules acun04530   Tight junction Brite KEGG Orthology (KO) [BR:acun00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     113487944 (CLDN19)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     113487944 (CLDN19)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     113487944 (CLDN19)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     113487944 (CLDN19)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:acun03037]     113487944 (CLDN19)    04147 Exosome [BR:acun04147]     113487944 (CLDN19)    04515 Cell adhesion molecules [BR:acun04515]     113487944 (CLDN19) Cilium and associated proteins [BR:acun03037]  Other cilia and associated proteins   Stereociliary proteins    113487944 (CLDN19) Exosome [BR:acun04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    113487944 (CLDN19)   Exosomal proteins of colorectal cancer cells    113487944 (CLDN19) Cell adhesion molecules [BR:acun04515]  Immunoglobulin superfamily   L1 family    113487944 (CLDN19) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 CD20 Motif Other DBs NCBI-GeneID:  113487944 NCBI-ProteinID:  XP_026718708 LinkDB All DBs Position 21 AA seq 140 aa AA seqDB search MVPTPRVQHLPPHLLLGFFGIIVSVVGMKCTKVGEEDPVTKSRIAVAGGVLFILSGLCTL AAVSLYATQVTYEFFRESTVPINARYEFGSALFIGWGAASLTMLGGSLLCCSCPAKERRG QQYYRQSQPSTAREIPWSGQ NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggtccccacacccagggtgcaacatctcccaccacatctcctcctgggcttcttcggc atcattgtgagcgtggtgggcatgaaatgcaccaaagttggtgaagaggatcctgttacc aagagccgcatcgctgttgctggaggtgtcctcttcatcctctccggtctgtgcacattg gccgctgtgtccttgtatgcaacgcaggtgacctatgagttcttcagagagagcactgtt cccatcaacgccaggtacgaattcggctcggctctcttcatcggctggggggctgccagc ctcaccatgctggggggctccctcctgtgctgctcctgccctgccaaggagcgccgagga cagcagtactaccggcagtcgcagccttcgacggctcgggagatcccctggagcgggcag tga

DBGET integrated database retrieval system