Athene cunicularia (burrowing owl): 113488912 Help Entry 113488912         CDS       T05777                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism acun  Athene cunicularia (burrowing owl) Pathway acun04010   MAPK signaling pathway acun04012   ErbB signaling pathway acun04068   FoxO signaling pathway acun04137   Mitophagy - animal acun04140   Autophagy - animal acun04150   mTOR signaling pathway acun04210   Apoptosis acun04218   Cellular senescence acun04370   VEGF signaling pathway acun04371   Apelin signaling pathway acun04540   Gap junction acun04625   C-type lectin receptor signaling pathway acun04810   Regulation of actin cytoskeleton acun04910   Insulin signaling pathway acun04912   GnRH signaling pathway acun04916   Melanogenesis Brite KEGG Orthology (KO) [BR:acun00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     113488912 (NRAS)    04150 mTOR signaling pathway     113488912 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     113488912 (NRAS)    04137 Mitophagy - animal     113488912 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:acun04131]     113488912 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acun04147]     113488912 (NRAS)    04031 GTP-binding proteins [BR:acun04031]     113488912 (NRAS) Membrane trafficking [BR:acun04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     113488912 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     113488912 (NRAS) Exosome [BR:acun04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113488912 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    113488912 (NRAS)   Exosomal proteins of breast cancer cells    113488912 (NRAS)   Exosomal proteins of colorectal cancer cells    113488912 (NRAS) GTP-binding proteins [BR:acun04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     113488912 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc FeoB_N RsgA_GTPase GTP_EFTU Arf IL23 Motif Other DBs NCBI-GeneID:  113488912 NCBI-ProteinID:  XP_026720138 LinkDB All DBs Position 26 AA seq 123 aa AA seqDB search MRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVD TKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSEDGNQGCMGLSC IVM NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgcgggatcagtacatgagaactggggaaggattcctctgtgtttttgccattaacaac agtaaatcgtttgctgacattaacctttacagagagcagatcaagagagtgaaagattca gatgatgtgccaatggtgctagttgggaataagtgtgatttgcccacaagaacagtagac acaaaacaggctcaagaattagcaaagagctatggaatccccttcatagagacatctgct aaaacaagacagggtgtggaagatgctttttacacactggtgagagagatccggcagtac cggatgaaaaagcttaacagcagtgaagatgggaatcaaggctgtatgggattgtcttgc attgtgatgtga

DBGET integrated database retrieval system