Athene cunicularia (burrowing owl): 113489916 Help Entry 113489916         CDS       T05777                                  Symbol CDO1 Name (RefSeq) cysteine dioxygenase type 1   KO K00456   cysteine dioxygenase [EC:1.13.11.20] Organism acun  Athene cunicularia (burrowing owl) Pathway acun00270   Cysteine and methionine metabolism acun00430   Taurine and hypotaurine metabolism acun01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:acun00001]  09100 Metabolism   09105 Amino acid metabolism    00270 Cysteine and methionine metabolism     113489916 (CDO1)   09106 Metabolism of other amino acids    00430 Taurine and hypotaurine metabolism     113489916 (CDO1) Enzymes [BR:acun01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.20  cysteine dioxygenase      113489916 (CDO1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CDO_I PCO_ADO Motif Other DBs NCBI-GeneID:  113489916 NCBI-ProteinID:  XP_026721799 UniProt:  A0A663MXK5 LinkDB All DBs Position Z AA seq 129 aa AA seqDB search MILCWGEGHGSSIHDHTDSHCFMKILQGNLKETLFEWPEKKGNGEMTKKSERVLRENQCA YINDSIGLHRVENISHTESAVSLHLYSPPFDSCNTFDQRTGHKHKVKMTFYSQFGERTVC ATAVPQENN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgatattgtgctggggtgaagggcatggcagcagcatccatgatcacactgactcacac tgctttatgaagatcctccagggaaatctaaaggagacactgtttgaatggcctgagaaa aaagggaatggtgaaatgactaagaaatcagaacgagttttgagggaaaatcagtgtgcc tacattaatgactccattggcctgcaccgtgtggagaacataagccacactgaatctgct gttagcctgcatttgtacagcccgcccttcgacagctgtaacacctttgatcagaggact ggacacaagcacaaagtcaaaatgactttctacagccagtttggagaaagaactgtctgt gcaacagcagtgccacaggagaacaactga

DBGET integrated database retrieval system