Athene cunicularia (burrowing owl): 113489985 Help Entry 113489985         CDS       T05777                                  Name (RefSeq) calmodulin, striated muscle   KO K02183   calmodulin Organism acun  Athene cunicularia (burrowing owl) Pathway acun04020   Calcium signaling pathway acun04070   Phosphatidylinositol signaling system acun04114   Oocyte meiosis acun04218   Cellular senescence acun04261   Adrenergic signaling in cardiomyocytes acun04270   Vascular smooth muscle contraction acun04371   Apelin signaling pathway acun04625   C-type lectin receptor signaling pathway acun04744   Phototransduction acun04910   Insulin signaling pathway acun04912   GnRH signaling pathway acun04916   Melanogenesis Brite KEGG Orthology (KO) [BR:acun00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     113489985  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:acun01009]     113489985   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:acun04131]     113489985    03036 Chromosome and associated proteins [BR:acun03036]     113489985   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acun04147]     113489985 Protein phosphatases and associated proteins [BR:acun01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      113489985 Membrane trafficking [BR:acun04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     113489985 Chromosome and associated proteins [BR:acun03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      113489985 Exosome [BR:acun04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    113489985 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF_EFCAB10_C EH SPARC_Ca_bdg EF-hand_11 EFhand_Ca_insen Dockerin_1 UPF0154 Caleosin DUF5580_M FCaBP_EF-hand SurA_N_2 Fe_hyd_lg_C SurA_N_3 SPEF2_C Motif Other DBs NCBI-GeneID:  113489985 NCBI-ProteinID:  XP_026721897 LinkDB All DBs Position 1 AA seq 149 aa AA seqDB search MAERLSEEKIAEFKEAFSLFDRDGDGCITTKELGTVMRSLGQNPTEAELQDMVGEVDADG SGTIDFPEFLSLMARKMRDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE EVDEMIKEADCNNDGQVNYEEFVRMMTEK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgagcggctgtcggaggagaagatcgctgagtttaaggaggctttttcccttttt gaccgggatggagacggttgcatcaccacgaaggagttgggcaccgtcatgcgctcgctg gggcaaaaccccactgaagcggagctgcaggacatggtgggggaggtggatgccgacggc agcggcaccatcgacttccccgagttcctctcgctgatggcgaggaagatgagggacacg gacagcgaggaggagatccgcgaggctttccgcgtcttcgataaggacggcaacggctac atcagcgcggcggagctgcggcacgtcatgaccaacctgggcgagaagttgacagacgag gaggtggatgagatgatcaaggaggccgactgcaacaacgacgggcaggtcaactatgag gagttcgtgaggatgatgacggagaagtga

DBGET integrated database retrieval system