Athene cunicularia (burrowing owl): 113491139 Help Entry 113491139         CDS       T05777                                  Symbol CBY1 Name (RefSeq) protein chibby homolog 1   KO K23402   protein chibby 1 Organism acun  Athene cunicularia (burrowing owl) Pathway acun04310   Wnt signaling pathway Brite KEGG Orthology (KO) [BR:acun00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     113491139 (CBY1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:acun03037]     113491139 (CBY1) Cilium and associated proteins [BR:acun03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    113491139 (CBY1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Chibby Taxilin LapA_dom Motif Other DBs NCBI-GeneID:  113491139 NCBI-ProteinID:  XP_026723664 UniProt:  A0A663MJ18 LinkDB All DBs Position 1 AA seq 126 aa AA seqDB search MPLFGNTFSPKKTPPRKCASLSNLHLLDRSTREIELGLEYGIPTMNLAGQSLKFENGQWV AESGSFTGDRREMQRLRKRNQQLEEENNLLRLKVDILLDMLSETTAESHLMEKELEELKN HSRRRK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctctcttcgggaacaccttcagccccaagaagacccccccccggaaatgtgcctct ctctccaacctgcacttgttggatagatcgacccgtgagattgagcttggcctggagtat ggcatccctactatgaacctcgctggccagagcctgaagtttgaaaatggccagtgggtg gcagaatcaggaagcttcacaggggatcgcagggaaatgcagcgcttgcgcaaacgaaac cagcagctagaggaagaaaacaacctccttcggctgaaagtggatattttgctggacatg ctctctgagactacagctgagtcccacctgatggagaaggagctggaggaactgaagaac cacagccggaggaggaagtga

DBGET integrated database retrieval system