Alicyclobacillus curvatus: JZ785_08420 Help Entry JZ785_08420       CDS       T08166                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism acur  Alicyclobacillus curvatus Pathway acur01100   Metabolic pathways acur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acur00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JZ785_08420    00074 Mycolic acid biosynthesis     JZ785_08420   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JZ785_08420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Guanylate_cyc DUF7080 Motif Other DBs NCBI-ProteinID:  QSO53820 LinkDB All DBs Position complement(1704844..1705077) Genome browser AA seq 77 aa AA seqDB search MSDTLSRVKSIIVDRLGVDEVKIVPTATFKDDLGADSLDVVELIMELEDEFDMEISDEDA EKIKTVGDVVTYIDAHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtccgatacactgtctcgcgttaagagcatcattgtggaccgccttggggttgatgaa gtaaaaatcgttccgacggccacgtttaaagatgatttaggtgctgactcactcgacgtt gtagagctcatcatggaactcgaagacgagtttgacatggagatctcagacgaagatgct gaaaagattaaaactgttggtgatgtagttacatatatcgacgcgcatcaataa

DBGET integrated database retrieval system