Acuticoccus sp. I52.16.1: MRB58_22195 Help Entry MRB58_22195       CDS       T08076                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism acut  Acuticoccus sp. I52.16.1 Brite KEGG Orthology (KO) [BR:acut00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:acut03032]     MRB58_22195    03036 Chromosome and associated proteins [BR:acut03036]     MRB58_22195    03400 DNA repair and recombination proteins [BR:acut03400]     MRB58_22195 DNA replication proteins [BR:acut03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     MRB58_22195 Chromosome and associated proteins [BR:acut03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     MRB58_22195 DNA repair and recombination proteins [BR:acut03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       MRB58_22195 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 SIMPL HU-CCDC81_bac_2 DUF2267 DUF937 HU-CCDC81_euk_1 PheRS_DBD1 Motif Other DBs NCBI-ProteinID:  UOM34491 LinkDB All DBs Position 4969537..4969812 Genome browser AA seq 91 aa AA seqDB search MKKAELAAEVAEQAGIDAKAAAKAVDATFNAIIGAMKSGDEVRITNFGVFSVTDRPESQG RNPQTKEPITIKAAKVPKFKPGKPLKDALNA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaagaaagccgaactcgccgccgaggtggcggagcaagccggcatcgacgccaaggcc gccgccaaggccgtcgacgccacgttcaacgccatcatcggtgcgatgaaatctggcgat gaagtccgcatcaccaacttcggtgtgttcagcgtgacggaccgccccgagtcgcagggt cgcaaccctcagacgaaggagcccatcacgatcaaggcggcgaaggtcccgaaattcaag ccgggcaagccgctgaaggacgccctcaacgcgtaa

DBGET integrated database retrieval system