Acinetobacter sp. TGL-Y2: AMD27_01145 Help Entry AMD27_01145       CDS       T04425                                  Name (GenBank) DNA-binding protein   KO K03746   DNA-binding protein H-NS Organism acv  Acinetobacter sp. TGL-Y2 Brite KEGG Orthology (KO) [BR:acv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:acv03036]     AMD27_01145    03400 DNA repair and recombination proteins [BR:acv03400]     AMD27_01145 Chromosome and associated proteins [BR:acv03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     AMD27_01145 DNA repair and recombination proteins [BR:acv03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       AMD27_01145 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS DUF883 DUF4168 dUTPase_2 Cnd1_N DUF5667 DUF7645 DUF87 Rpf1_C Motif Other DBs NCBI-ProteinID:  AMW77642 UniProt:  A0A145WMZ8 LinkDB All DBs Position 261709..262032 Genome browser AA seq 107 aa AA seqDB search MPDISNLSVEELKKLTAQAEALIESKKDEAVEEAYNQIIKIAESAGMTLEQFIEYGSHKR KKTTRKAVEPRYRNKSNSAETWTGRGKQPRWLVAQLDKGAKLEDFLI NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgccagatatcagtaatctatccgttgaagagttgaaaaagttaacagctcaagctgaa gcactgattgaatcaaagaaagatgaagcagtggaagaagcctacaatcaaattattaag attgcagaatctgcgggtatgaccttagagcagttcattgaatacggttcgcataaacgt aagaaaaccacacgtaaagcagttgagccacgttaccgcaataaaagtaacagtgctgag acgtggactggtcgcggtaaacaaccccgttggttggtcgctcaacttgataaaggtgca aaattagaagatttcctaatctaa

DBGET integrated database retrieval system