Acinetobacter sp. TGL-Y2: AMD27_08725 Help Entry AMD27_08725       CDS       T04425                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism acv  Acinetobacter sp. TGL-Y2 Brite KEGG Orthology (KO) [BR:acv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:acv03032]     AMD27_08725    03036 Chromosome and associated proteins [BR:acv03036]     AMD27_08725    03400 DNA repair and recombination proteins [BR:acv03400]     AMD27_08725 DNA replication proteins [BR:acv03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AMD27_08725 Chromosome and associated proteins [BR:acv03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AMD27_08725 DNA repair and recombination proteins [BR:acv03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AMD27_08725 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AMW78954 UniProt:  A0A143G3Z7 LinkDB All DBs Position complement(1831903..1832175) Genome browser AA seq 90 aa AA seqDB search MNKSELIDAIAEKGGLSKTDAGKALDATIASIGEALKKGDTVTLVGFGTFSVKDRAARTG RNPKTGEELQIKASKVPSFKAGKGLKDSVA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaatcagaattaatcgacgcgattgcagagaaagggggattgtctaagactgat gcaggtaaagcattggacgcgactattgcttcaattggtgaagcgttgaaaaagggtgat actgtaactttagttggttttggtacatttagcgttaaggaccgtgcagcacgtactggt cgtaaccctaaaaccggtgaagagctgcaaattaaagcaagcaaagtaccaagctttaaa gcaggtaaaggacttaaagattctgttgcttaa

DBGET integrated database retrieval system