Acinetobacter sp. DUT-2: A0J50_07565 Help Entry A0J50_07565       CDS       T04353                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism acw  Acinetobacter sp. DUT-2 Pathway acw00190   Oxidative phosphorylation acw01100   Metabolic pathways acw02020   Two-component system Module acw_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:acw00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     A0J50_07565  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     A0J50_07565 Enzymes [BR:acw01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      A0J50_07565 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB PIGBOS1 Motif Other DBs NCBI-ProteinID:  AMO40522 LinkDB All DBs Position complement(1604565..1604666) Genome browser AA seq 33 aa AA seqDB search MWYFAWILGILMACFAGVLSALYIEHHQDLDEE NT seq 102 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggatcctaggcattttgatggcatgttttgcgggtgtactcagc gcgctttatatcgaacatcatcaagatttagatgaggaataa

DBGET integrated database retrieval system