Acinetobacter sp. DUT-2: A0J50_11605 Help Entry A0J50_11605       CDS       T04353                                  Name (GenBank) monooxygenase   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism acw  Acinetobacter sp. DUT-2 Pathway acw00361   Chlorocyclohexane and chlorobenzene degradation acw00362   Benzoate degradation acw00623   Toluene degradation acw01100   Metabolic pathways acw01120   Microbial metabolism in diverse environments acw01220   Degradation of aromatic compounds Module acw_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:acw00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     A0J50_11605    00361 Chlorocyclohexane and chlorobenzene degradation     A0J50_11605    00623 Toluene degradation     A0J50_11605 Enzymes [BR:acw01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      A0J50_11605     1.14.13.244  phenol 2-monooxygenase (NADH)      A0J50_11605 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM Motif Other DBs NCBI-ProteinID:  AMO41226 LinkDB All DBs Position 2461505..2461771 Genome browser AA seq 88 aa AA seqDB search MSKVYLALQDNDTSRYILEAIEEDNPEASIQYLPAMIRIESETDLVIKAKSVSEKLGQDW DIQSLQLNMITLGGNVEEDDDTFRLHWN NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgtctaaagtctatctcgcattacaagacaacgatacttcacgctacatcctcgaagcg attgaagaagataaccctgaagcttcaattcagtatttacccgccatgattcgcattgaa agtgaaactgatttggtgattaaagctaaaagcgtatctgaaaaactaggccaagattgg gacatccaatcgttacaactcaacatgattacgctaggcggcaacgtcgaagaagatgat gacactttccgccttcactggaattaa

DBGET integrated database retrieval system