KEGG   Azotobacter chroococcum: Achr_12850
Entry
Achr_12850        CDS       T03640                                 
Symbol
proS
Name
(GenBank) prolyl-tRNA synthetase
  KO
K01881  prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
acx  Azotobacter chroococcum
Pathway
acx00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Achr_12850 (proS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acx01007]
    Achr_12850 (proS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acx03016]
    Achr_12850 (proS)
Enzymes [BR:acx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     Achr_12850 (proS)
Amino acid related enzymes [BR:acx01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   Achr_12850 (proS)
Transfer RNA biogenesis [BR:acx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Achr_12850 (proS)
 Prokaryotic type
    Achr_12850 (proS)
SSDB
Motif
Pfam: tRNA-synt_2b tRNA_edit HGTP_anticodon
Other DBs
NCBI-ProteinID: AJE20762
UniProt: A0A0C4WR29
LinkDB
Position
complement(1417307..1419022)
AA seq 571 aa
MRTSQYLLSTLKETPSDAVVISHQLMLRAGMIRKLASGLYTWLPLGLRALRKAEAIVREE
MNKAGALEVLMPAIQPAELWQESGRWEQYGPELLRIRDRHDREFCVGPTHEEVITDLARN
ELNSYKQLPINFYQIQTKFRDEIRPRFGLMRGREFLMKDAYSFHLTQESLQETYDRMHQA
YCNIFSRLGLDFRPVQADTGSIGGTGSHEFHVLAESGEDDIAFSDSSDYAANIEKAEAIP
RETARGAASEELRLVDTPDARTIDELVQQFKLPVEKTVKTLVVHGIEEGQLVALIVRGDH
ELNEIKAANLAQVASPLVFASEAEIRAAIGAGPGSLGPLNLPIPAIVDRSVALSSDFGAG
ANLDGKHYFGLNWERDLPLPEIADLRNVVAGDPSPDGRGTLEIKRGIEVGHIFQLGTKYS
EALNCKVLGENGKPVTLIMGCYGIGVSRVVAAAIEQNYDERGILWPEALAPFQIALVPMK
YESAVVKEATDRLYAELVAAGYEVLLDDRDKKTSPGVKFADMELIGIPHRIVVSERGLAE
GTLEYKSRRETDVQAIPAADLVTFLSNRIGR
NT seq 1716 nt   +upstreamnt  +downstreamnt
atgcgcaccagtcagtatctgctctcgaccctcaaggaaaccccctccgatgccgtggtg
atcagccaccagctaatgctgcgcgccgggatgatccgcaagctggcctccggtctctac
acctggctgccgctggggttgcgcgccctgcgcaaggccgaggcgatcgtccgcgaggag
atgaacaaggccggcgccctggaggtgctgatgccggccatccagcccgccgagctgtgg
caggagtccggccgctgggagcagtacggccccgaactgctgcgcatccgcgaccgtcac
gaccgcgagttctgcgtcggcccgacccacgaggaagtgatcaccgacctggcgcgcaac
gagctgaacagctacaagcagctgccgatcaacttctaccagatccagaccaagttccgc
gacgagatccgcccgcgcttcggcctgatgcgcggccgcgaattcctgatgaaggacgcc
tactccttccatctgacccaggagtcgctgcaggaaacctacgaccgcatgcaccaggcc
tactgcaacatcttcagccgactgggcctcgacttccgtccggtgcaggccgacaccggc
tcgatcggcggcaccggctcccacgaattccacgtgctggccgagtccggcgaggacgac
atcgccttcagcgacagctccgactacgccgccaacatcgagaaggccgaggccatcccg
cgcgagaccgcgcgtggcgccgccagcgaggaactgcgcctggtcgacacccccgacgcc
aggaccatcgacgagctggttcagcagttcaagctgcccgtcgagaagaccgtcaagacc
ctggtggtgcacggcatagaggaaggccagctggtcgccctgatcgttcgcggcgaccac
gagctgaacgaaatcaaggccgccaacctggcgcaggtcgccagcccgctggtattcgcc
tcggaagccgagatccgcgcggcgatcggcgccggtcccggctccctcggcccgctgaac
ctgccgattccggccatcgtcgaccgctcggtggcgctctcgagcgacttcggcgccggc
gccaacctcgacggcaagcactacttcggcctcaactgggagcgcgacctgccgctgccg
gaaatcgccgacctgcgcaacgtggtcgccggcgaccccagcccggatggtcggggcacc
ctggagatcaagcgcggcatcgaggtcggtcacatcttccagctcggcaccaagtacagc
gaggcgctgaactgcaaggtgctcggcgagaacggcaagccggtgaccctgatcatgggc
tgctacggcatcggcgtatcccgcgtggtcgccgccgccatcgagcagaactacgacgag
cgcggcatcctctggccggaggcgctggcgccgttccagatcgccctggtgccgatgaag
tacgaaagcgccgtggtcaaggaagccaccgaccgtctgtacgccgagctggtcgccgcc
ggctacgaggtgctgctcgacgatcgcgacaagaagaccagccccggggtgaagttcgcc
gacatggagctgatcggcattccccaccgcatcgtggtgagcgaacgcggcctggccgaa
ggcaccctggagtacaagagccgccgcgaaaccgatgtccaggccatcccggccgccgac
ctcgtgaccttccttagcaaccgcattggccgctga

DBGET integrated database retrieval system