KEGG   Azotobacter chroococcum: Achr_15710
Entry
Achr_15710        CDS       T03640                                 
Name
(GenBank) Type I secretion system ABC transporter, HlyB family
  KO
K11004  ATP-binding cassette, subfamily B, bacterial HlyB/CyaB
Organism
acx  Azotobacter chroococcum
Pathway
acx02010  ABC transporters
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Achr_15710
   03070 Bacterial secretion system
    Achr_15710
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_15710
   02044 Secretion system [BR:acx02044]
    Achr_15710
Transporters [BR:acx02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    Achr_15710
Secretion system [BR:acx02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter
   Achr_15710
SSDB
Motif
Pfam: ABC_membrane ABC_tran Peptidase_C39 SMC_N AAA_16 ABC_ATPase AAA_29 AAA_22 AAA_18 AAA_21 AAA_30 DUF87 PRK MeaB Vma12
Other DBs
NCBI-ProteinID: AJE21030
UniProt: A0A0C4WNE4
LinkDB
Position
1720041..1722191
AA seq 716 aa
MSAAHQGAGASSSVDSGLACLVMLARFHNIAAAPEQLVHEFAEDGRPFAQAELLLAAKRL
GLKAKSARSKVERLVHTPLPAIAASTDGRFFIVARIDDGKALIHDPLAQRPEVLSFEDLA
ARWTGELILIRSEASLAGELSKFDFTWFIPAIVKYRKLLGEVLLVSFVLQIFALVTPLFF
QVVMDKVLVHRGLSTLDVIAIGLLGIMLFETALSGLRSYVFAHTASRIDVELGSRLFRHL
IGLPLAYFQARRVGDSVARVRELENIRSFLTGNAITLILDVLFSVVFIAVMFYYSGWLTL
IVLLSLPLYVLICLFVTPLLRARLQESFNRGAENQAFLVETVNGIDTLKAMAVEPQMGRR
WDNQLAGYVAASFKTHTLSTIANESVGLVGKLVTVATLWLGARLVIDGELSVGQLIAFNM
LAGRVSQPIMRLAQLWTSFQQTGVSVQRLGDILNTRTELAQTTRSALPPLKGQVEFDQVH
FRYRPDGSEVLRGINLSIRPGEVIGVVGRSGSGKSTLTRLLQRLYVPERGRVLVDGMDLA
LADVSSLRRQIGVVLQDNLLFNRSIRENIALTDPGAPVEAVIQAARLAGAHEFILELPEG
YDTLVGEHGASLSGGQRQRIAIARALIGNPRLLIFDEATSALDYESERIVQQNMKAICQG
RTVIIIAHRLSAVRDAHRILVMDRGQIVEQGSHAELLAHQAGHYSRLYRLQQGDAA
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgtcagccgcacaccagggagcaggtgcgtcctcttccgtcgatagcggacttgcatgc
ctggtcatgctggcccgcttccataatattgccgccgctcccgaacaactcgttcatgaa
ttcgccgaggatggccgccccttcgcccaggcggaactgctgctggccgccaagcggctg
ggcctcaaggccaagtcggctcgcagcaaggtcgagcgcctcgtccacaccccgcttcct
gccattgccgcttcgaccgacgggcgcttcttcatcgtcgcgcgcatcgacgacggcaag
gcactgatccacgatcccctggcccagcgtcccgaggtcttgagcttcgaggatctggcg
gcgcgctggaccggcgagctgattttgatccgctccgaggcttccctggccggcgagctg
tcgaaattcgacttcacctggttcatcccggccatcgtcaagtatcgcaagctgcttggc
gaggtgctgctggtgtcctttgtgctgcagatctttgccctggtcacacccttgttcttc
caggtggtgatggacaaggtgctggtgcatcgcggcttgagcaccctggacgtcatcgcc
atcggcctgctcggcatcatgctgttcgagactgccctgagcggcctgcgcagctacgtg
ttcgcccacactgccagccgcatcgatgtcgaattgggttctcggctgtttcgccatctg
atcggtctgccgctggcgtacttccaggctcgccgggtcggcgactcggtggcgcgggta
cgcgagctggaaaacattcgcagtttcctcaccggcaacgccatcaccctgatcctcgac
gtgctgttctcggtggtgttcattgccgtgatgttctactacagcggctggctgaccctg
atcgtgctgctctcgctaccgctgtatgtcctcatctgcctgttcgtcacgccactgctg
cgtgcccgcctgcaggagagcttcaaccgcggtgcggagaaccaggccttcctggtggaa
accgtcaacggcatcgacaccctcaaggccatggcggtggagccgcagatggggcgcagg
tgggacaaccaactggccggctacgtggcagccagcttcaagacccacaccctctcgacc
atcgccaacgaaagcgtcggcctggtcggcaagctggtgaccgtcgctaccttatggctt
ggcgcgcggctggtaatcgatggtgagctgtcggtcgggcaactgatcgccttcaacatg
ctcgccggccgcgtgtcgcagccgatcatgcgcctggcccagttgtggaccagtttccag
cagaccggcgtctcggtgcagcgtctgggcgacatcctcaatacccgtaccgaactggcc
cagaccacacgcagcgcactgccgccgctcaaggggcaggtggaattcgatcaggtgcat
tttcgctaccggccggacggctccgaggtgctgcgcggcatcaacctgagcatccgcccc
ggcgaggtgattggcgtggtcgggcgctccggctccggcaagagcaccctgacccgcctg
ctgcaacgcctctacgtacccgagcgtggccgcgtactggtggacggcatggacctggcg
ctggctgatgtctcctcgctgcgtcggcagatcggtgtggtgctgcaggacaacctgctg
ttcaaccgcagcatccgcgagaacatcgccctgaccgatcccggcgcgccggtcgaggcg
gtgatccaggccgctcggctggccggtgcgcacgagttcatcctcgagctgccggaaggc
tacgacaccctcgtcggcgaacacggggcctcgctctccggggggcagcgtcagcgcatc
gccatcgcccgggcgctgatcggcaatccgcgcctcctcatcttcgacgaggccaccagc
gccctggactacgagtccgagcggatcgtccagcagaacatgaaggccatctgccaggga
cgcacggtgatcatcatcgcccaccggctatccgcggtgcgcgatgcccaccgcattctg
gtcatggatcgtgggcagatcgtcgagcagggcagccatgccgagttgctggctcatcag
gccggccactattcgcgcctgtaccgcctgcaacagggggatgccgcatga

DBGET integrated database retrieval system