KEGG   Azotobacter chroococcum: Achr_15720
Entry
Achr_15720        CDS       T03640                                 
Symbol
hlyD
Name
(GenBank) Type I secretion membrane fusion protein, HlyD family
  KO
K11003  membrane fusion protein, hemolysin D
Organism
acx  Azotobacter chroococcum
Pathway
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_15720 (hlyD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_15720 (hlyD)
   02044 Secretion system [BR:acx02044]
    Achr_15720 (hlyD)
Transporters [BR:acx02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   Achr_15720 (hlyD)
Secretion system [BR:acx02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter
   Achr_15720 (hlyD)
SSDB
Motif
Pfam: HlyD_3 HlyD_D23 CusB_dom_1 Biotin_lipoyl_2 Biotin_lipoyl
Other DBs
NCBI-ProteinID: AJE21031
UniProt: A0A0C4WLF5
LinkDB
Position
1722188..1723612
AA seq 474 aa
MSQPSAARSLLGRYRSVWRQAWRNRQALDAPPRLPHEVQFLPAALALQEQPVHPAPRYIQ
WTIMAFAALALLWACLGEIDVVATASGRIVPSGRSKIVQPSEVAVVKAIHVRDGQSVKAG
QLLVELDAQITGADVERLKSDLLAAQVDNARSTALLEAIQTRREPPSLVERLPQASPEQR
LAAQRWLQGQYLELQSALDQAKAEIEQRAAEISSAKASVATLQQALAISRRLASDYKELL
KEQFMTRNAYLEKEQLRLDQERELAAQQGRIVELAAARKAAESRHASILAETRRAMLDLQ
HESEQRAAAFTQELKKAEQRNRLMGLTAPVDGTVQQLDIHTPGGVVTAAQPLMVIVPLDE
PVEVEALLENKDIGFVRPGQEVEIKVETFTFTKYGVVHGTMTSISNDAIEDEKLGLVYSV
RIQLKEKHVRVGDQEIALSPGMAVRAEVKTDKRKVIEYFLSPLKQYQDESLGER
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgagccagccctccgccgcacgatccctgttggggcgctatcgcagcgtctggcgtcag
gcctggcgcaatcgccaagctctcgacgcgccaccgcgcctgcctcacgaagtgcaattc
ctgccggcggccttggctctgcaggagcagccggtccatccggcgccgcgttacatccag
tggaccatcatggccttcgccgccctggccctgctgtgggcctgcctcggcgagatcgat
gtggtcgccaccgccagcggcaggatcgtgcccagcggcaggagcaagatcgtccagccc
agcgaagtggcggtggtcaaggccatccatgtgcgtgacggtcaatcggtcaaggctggc
caactgctggtcgagctggacgctcagatcacgggtgccgacgtcgagcgcctgaagagc
gacctgctggctgcccaggtcgacaacgcccgctccacggcattgctggaagcgatccag
acacggcgcgaaccgccttcgctggtcgaacgcctcccacaagccagccctgagcagcga
ctggccgcccagcgctggctgcagggccagtacctggagttgcaaagcgccctcgaccag
gcgaaggccgagatcgagcaacgtgcggcggaaatctcgtccgccaaggccagcgtggct
accctccagcaggccctggcgatcagccggaggctggcgagcgactacaaggagctgctg
aaagagcaattcatgacccgtaatgcctacctggaaaaggagcagctgcgcctcgaccag
gaacgcgaactggccgcccagcaggggcgtatcgtcgagctcgcggcggccaggaaggcc
gccgaaagccgccatgccagcatcctcgccgaaacccgccgcgccatgctcgacctgcag
cacgagtccgaacagcgcgctgcggcctttactcaggaattgaagaaggccgagcaacgc
aaccgcctgatgggcctcaccgccccggtggatggcaccgtacagcagttggatatccat
acccctggcggggtggtcaccgccgcccagccgctgatggtcatcgtccccctcgacgaa
ccggtggaagtggaggccctgctggaaaacaaggacatcggcttcgtgcgtccggggcag
gaggtggagatcaaggtcgagacttttaccttcaccaagtacggcgtggtccacggcacc
atgaccagcatctccaacgatgccattgaggacgagaagttggggctggtctacagcgtg
cggattcagctcaaggagaagcacgttcgcgtgggagaccaagagattgctttatcgcca
gggatggcggtgcgggcggaggtgaagactgacaagcgcaaggtgatcgaatacttcttg
agtcccctcaagcagtatcaggacgagagtctgggagagcggtaa

DBGET integrated database retrieval system