KEGG   Azotobacter chroococcum: Achr_23030
Entry
Achr_23030        CDS       T03640                                 
Symbol
glnS
Name
(GenBank) glutaminyl-tRNA synthetase
  KO
K01886  glutaminyl-tRNA synthetase [EC:6.1.1.18]
Organism
acx  Azotobacter chroococcum
Pathway
acx00970  Aminoacyl-tRNA biosynthesis
acx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Achr_23030 (glnS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acx01007]
    Achr_23030 (glnS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acx03016]
    Achr_23030 (glnS)
Enzymes [BR:acx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.18  glutamine---tRNA ligase
     Achr_23030 (glnS)
Amino acid related enzymes [BR:acx01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Achr_23030 (glnS)
Transfer RNA biogenesis [BR:acx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Achr_23030 (glnS)
 Prokaryotic type
   Other AARSs
    Achr_23030 (glnS)
SSDB
Motif
Pfam: tRNA-synt_1c tRNA-synt_1c_C
Other DBs
NCBI-ProteinID: AJE21741
UniProt: A0A0C4WMU3
LinkDB
Position
complement(2564978..2566651)
AA seq 557 aa
MSKPETPAAAANFLRPIVQADLESGKHAKIVTRFPPEPNGYLHIGHAKSICLNFGLAQEF
GGECNLRFDDTNPAKEDQEYIDAIKSDVQWLGFQWAGEERYASNYFDQLFAWAVHLIEAG
KAYVCDLSPDEARAYRGSLTEPGRNSPFRERSVEENLDLFARMKAGEFPDGARALRAKID
MASPNMNLRDPILYRIRHAHHHQTGDKWCIYPSYDFTHGQSDAIEGITHSICTLEFEDHR
PLYEWFLANLPVPARPRQYEFARLNLNYTITSKRKLKQLVDEGHVNGWDDPRMSTLSGYR
RRGYTPASIRHFCDLIGVNRAGGLVDIGMLEFAIREDLDANASRAMCVLKPLKVVITNYP
QGQVESLELPRHPKQDMGVRVLPFSREIFIDASDFEEVPPAGYKRLIPGGEVRLRGSYVI
RADEAVKDEQGNIVELRCSYDENTLGKNPEGRKVKGVIHWVPAEGSVECEVRLYDRLFKA
ANPEKTDEEGGSFLDNINPESLVVLKGCRAEPSLANAAPEERFQFEREGYFCADLKDSQP
GAPVFNRTVTLRDSWGQ
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgagcaagcccgagactcccgccgctgccgcgaacttcctccgcccgatcgtccaggcc
gacctggagtcgggcaagcacgccaagatcgtcacccgcttcccgccggagcccaatggc
tacctgcacatcggccacgccaagtcgatctgcctgaacttcggcctggcccaggagttc
ggcggcgagtgcaacctgcgcttcgacgacaccaacccggccaaggaagaccaggagtac
atcgacgcgatcaagagcgacgtgcagtggctgggcttccagtgggccggcgaggagcgc
tacgcctccaactacttcgaccagctgttcgcctgggccgtgcacctgatcgaggccggc
aaggcctacgtctgcgacctgtcgccggacgaggcgcgcgcctaccgcggcagtctgacc
gagccgggcaggaacagcccgttccgcgagcgttcggtggaggagaacctcgatctgttc
gcccgcatgaaggccggcgagttccccgatggcgcccgtgcgctgcgcgcgaagatcgac
atggcctcgccgaacatgaacctgcgcgacccgatcctctaccgcatccgccacgcccat
caccaccagaccggcgacaagtggtgcatctacccgagctacgacttcacccacggtcag
tcggacgccatcgaggggatcactcactcgatctgcaccctggagttcgaggaccaccgc
ccgctgtacgagtggttcctggccaacctgccggtgccggcccggccgcgccagtacgag
ttcgcccgcctcaacctgaactacaccatcaccagcaagcgcaagctcaagcaactggtc
gatgaggggcacgtcaacggctgggacgacccgcgcatgtcgaccctgtccggttatcgt
cgccgcggctacaccccggcctcgatccgtcatttctgcgacctgatcggcgtcaaccgc
gccggcggcctggtcgacatcggcatgctggaattcgccatccgcgaggatctcgacgcc
aacgcttcgcgtgccatgtgcgtgctcaagccgctgaaagtcgtcatcaccaactacccg
caaggccaggtcgagagcctcgagctgccgcgccatcccaagcaggacatgggcgtgcgc
gtgctaccgttctcccgcgagatcttcatcgacgccagcgacttcgaggaagtcccgccg
gccggctacaagcgcctgatccccggcggcgaagtgcgcctgcgcggcagctacgtgatc
cgcgccgacgaggcggtgaaggatgagcagggcaacatcgtcgagctgcgctgctcctac
gacgagaacaccctcggcaagaacccggaaggccgcaaggtcaagggtgtgatccactgg
gtgccggccgaaggtagcgtcgagtgcgaggtgcgcctgtacgaccgcctgttcaaggcc
gccaatccggagaagaccgacgaggagggcggcagcttcctcgacaacatcaacccggaa
tccctggtggtgctcaagggctgccgcgccgagccgtcgctggccaatgccgcgccggaa
gagcgcttccagttcgagcgcgaaggctacttctgcgccgacctgaaggattcgcagccg
ggcgctccggtgttcaaccgcaccgttaccctgcgcgattcctgggggcagtga

DBGET integrated database retrieval system