Azotobacter chroococcum: Achr_25050 Help Entry Achr_25050        CDS       T03640                                  Symbol cydX Name (GenBank) CydX   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism acx  Azotobacter chroococcum Pathway acx00190   Oxidative phosphorylation acx01100   Metabolic pathways acx02020   Two-component system Module acx_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:acx00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Achr_25050 (cydX)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Achr_25050 (cydX) Enzymes [BR:acx01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      Achr_25050 (cydX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB PIGBOS1 Motif Other DBs NCBI-ProteinID:  AJE21938 UniProt:  A0A0C4WIF7 LinkDB All DBs Position 2814110..2814226 Genome browser AA seq 38 aa AA seqDB search MWYFSWILGILLACGFGVINALWLETTMQMDEGPAGGE NT seq 117 nt NT seq  +upstreamnt  +downstreamnt atgtggtacttcagttggattctcggcatcctgctggcctgcggcttcggagtcattaac gccctgtggctggaaaccaccatgcaaatggatgagggtccggcgggtggcgagtga

DBGET integrated database retrieval system