Azotobacter chroococcum: Achr_27930 Help Entry Achr_27930        CDS       T03640                                  Symbol acp Name (GenBank) Acyl carrier protein 1   KO K02078   acyl carrier protein Organism acx  Azotobacter chroococcum Pathway acx01100   Metabolic pathways acx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Achr_27930 (acp)    00074 Mycolic acid biosynthesis     Achr_27930 (acp)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Achr_27930 (acp) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 Ribosomal_L50 HLH NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  AJE22215 UniProt:  A0A0C4WRN1 LinkDB All DBs Position complement(3145149..3145385) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQEAIDYINAHAQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaagatcgttgctgagcaacttggcgtcaaagaa gaggaagtcaccaatagcgcttcctttgtcgaagacctgggcgccgactctcttgacacc gttgagctggtgatggctctcgaagaggaattcgagaccgaaattccggacgaacaggcc gagaaaatcaccactgttcaggaagccatcgattacatcaatgcccacgcacaataa

DBGET integrated database retrieval system