KEGG   Azotobacter chroococcum: Achr_29930
Entry
Achr_29930        CDS       T03640                                 
Symbol
ptsO
Name
(GenBank) Phosphocarrier NPr protein
  KO
K02784  phosphocarrier protein HPr
Organism
acx  Azotobacter chroococcum
Pathway
acx02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    Achr_29930 (ptsO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_29930 (ptsO)
Transporters [BR:acx02000]
 Phosphotransferase system (PTS)
  Enzyme I and HPr
   Phosphocarrier protein HPr [TC:8.A.8]
    Achr_29930 (ptsO)
SSDB
Motif
Pfam: PTS-HPr
Other DBs
NCBI-ProteinID: AJE22406
UniProt: A0A0C4WP74
LinkDB
Position
3357620..3357892
AA seq 90 aa
MPACEITIINKLGLHARAAAKFVGVAGRYACAVRIGRAPESLVDGKSIMAVMMLAAGKGT
PIHLHTEGEQDCEALEALIELINNRFDEDE
NT seq 273 nt   +upstreamnt  +downstreamnt
atgcccgcctgcgaaatcaccatcatcaacaagcttgggctgcatgcccgggcagcggcc
aagttcgtcggggtcgccgggcgctacgcctgtgcggtgcgcatcggccgagcgccggag
agcctggtcgacggcaagagcatcatggcggtcatgatgctggcagctggcaagggaacg
cccattcacctgcataccgaaggcgaacaggactgcgaggcgctggaggcactgatcgag
ctgatcaacaatcgcttcgacgaagacgaataa

DBGET integrated database retrieval system