KEGG   Azotobacter chroococcum: Achr_30290
Entry
Achr_30290        CDS       T03640                                 
Symbol
fruA
Name
(GenBank) Fructose phosphotransferase system IIBC component
  KO
K02770  fructose PTS system EIIBC or EIIC component [EC:2.7.1.202]
Organism
acx  Azotobacter chroococcum
Pathway
acx00051  Fructose and mannose metabolism
acx01100  Metabolic pathways
acx01120  Microbial metabolism in diverse environments
acx02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:acx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Achr_30290 (fruA)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    Achr_30290 (fruA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_30290 (fruA)
Enzymes [BR:acx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     Achr_30290 (fruA)
Transporters [BR:acx02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    Achr_30290 (fruA)
SSDB
Motif
Pfam: PTS_IIB PTS_EIIC
Other DBs
NCBI-ProteinID: AJE22442
UniProt: A0A0C4WV13
LinkDB
Position
complement(3399837..3401585)
AA seq 582 aa
MNLLIVTACPNGMVTSVLCARLLEAAALRLGWTTRVEVHDPKAIGSPLSEGDIAAADLVV
VVKTGELALERFVGKRLVQSTPAEALQEPQRFLSEAAEHAEVLQAGAAAPAAAASAQPRL
VAVTACPTGVAHTFMAAEALQQAAKQLGYALQVETRGSVGARNLLDEAAIAAADVVLLAA
DIEVDTSRFAGKKIYRCGTGVALKQPQQTLRRALEEAVPQAGASAAAAAAPGKAATKSGP
YKHLLTGVSYMLPMVVAGGLLIALSFVFGIEAFKEEGSLAAALMQIGGDTAFKLMVPVLA
GYIAYSIADRPGLAPGMIGGLLAGSLGAGFIGGIIAGFLAGYCASALSRWLRLPQSLESL
KPILLIPLLASLFTGLVMIYVVGTPVAGMLAGLTDFLNGMGSTNAVLLGLLLGGMMCVDL
GGPVNKAAYAFSVGLLASQTYAPMAATMAAGMVPPLGMAIATVLARYKFAKAEREAGKAA
GVLGLCFISEGAIPFAAKDPLRVIPASIAGGALTGALSMFFGCKLMAPHGGLFVLAIPNA
INHALAYLLAIVAGSLLTGVLYAVLKRGEAVEAMPVPAVEQG
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgaatctgctgatcgtcactgcctgtccgaacggcatggtcaccagcgtgctctgcgca
cgcctgctggaggcggccgccctgcgtctgggctggaccacccgcgtcgaggtgcatgat
cccaaggcgatcggctcgccgctttccgaaggcgacatcgccgctgccgacctggtcgtc
gtggtcaagaccggcgagctggcgctcgagcgcttcgtcggcaagcgcctggtgcagtcc
accccggccgaggcgctgcaggagccgcaacgcttcctcagcgaggccgccgaacatgcc
gaggtgctccaggccggggcggccgcgccggctgcggcggcctcggcccagccgcggctg
gtggcggtgaccgcctgcccgaccggggtagcccacaccttcatggccgccgaggccctg
cagcaggccgccaaacagctcggctacgcgctgcaggtggaaacccgcggctcggtgggc
gcgcgcaacctgctcgacgaggcggccatcgccgccgccgacgtagtgctgctggccgcc
gacatcgaggtcgacaccagccgcttcgccggcaagaagatctaccgctgcggcaccggc
gtggccctcaagcagccgcagcagaccctgcgccgcgccctggaggaggcggtgccgcag
gctggcgcaagcgcagccgcggccgccgcgccgggcaaggcagcgaccaaaagcggcccc
tacaagcacctgctgaccggggtgtcctacatgctgccgatggtggtggccggcggcctg
ttgattgccctgtcgttcgtcttcggcatcgaggcgttcaaggaggagggcagcctggcc
gcggcgctgatgcagatcggcggcgacaccgcgttcaagctgatggtgccggtgctggcc
ggctacatcgcctattccattgccgaccgccccggcctggcgccagggatgatcggcggc
ctcttggccggcagcctgggggcgggcttcatcggaggcatcatcgccggcttcctcgcc
ggctattgcgccagcgcgctcagccgctggctgcgcctgccgcagagcctcgagtcgctc
aagccgatcctgctcatcccgctgctggccagcctgttcaccggtctggtgatgatctac
gtggtcggcacgccggtggccggcatgctcgccgggctgaccgatttcctcaacggcatg
ggcagcaccaacgccgtgctgctcggcctgctgctcggcgggatgatgtgcgtcgacctc
ggcgggccggtcaacaaggcggcctatgccttttcggtgggactgctggcctcgcagacc
tacgcgccgatggcggcgaccatggccgcgggcatggtgccgccgctcggcatggccatc
gccaccgtgctggcccgctacaagttcgccaaggccgagcgcgaggccggcaaggcggcc
ggcgtgctgggactgtgcttcatctccgagggggcgattcccttcgccgccaaggacccg
ctgcgggtgatcccggccagcatcgccggcggcgccctgaccggcgcgctgtcgatgttc
ttcggctgcaagctgatggcgccccacggcgggttgttcgtgctggcgattcccaacgcg
atcaaccacgcgctggcctacctgctggcgatcgtcgccggcagcctgctgaccggggtg
ctgtatgcggtgctcaagcgcggggaggcggtcgaggcgatgccggtgccggcggtggag
caggggtga

DBGET integrated database retrieval system