KEGG   Azotobacter chroococcum: Achr_34870
Entry
Achr_34870        CDS       T03640                                 
Symbol
secY
Name
(GenBank) preprotein translocase, SecY subunit
  KO
K03076  preprotein translocase subunit SecY
Organism
acx  Azotobacter chroococcum
Pathway
acx02024  Quorum sensing
acx03060  Protein export
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Achr_34870 (secY)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_34870 (secY)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Achr_34870 (secY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_34870 (secY)
Secretion system [BR:acx02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Achr_34870 (secY)
SSDB
Motif
Pfam: SecY DUF6185
Other DBs
NCBI-ProteinID: AJE22890
UniProt: A0A0C4WTD5
LinkDB
Position
complement(3886042..3887370)
AA seq 442 aa
MAKQGALSALSNGGLSELWARLRFLFLAIIVYRIGAHIPVPGINPDRLAELFQQNEGTIL
SLFNMFSGGALERMSIFALGIMPYISASIIMQLMTVVSPQLEQLKKEGEAGRRKISQYTR
YGTLVLAIIQAFGMSVGLASQGVAFAADFSFHFVAVTTFVAGAMFMMWLGEQITERGVGN
GISMLIFAGIVAGLPAAIGQSFESARQGDINIIALLSVALLAVAIIGFVVFVERGQRRIA
VHYAKRQQGRKVFAAQTSHLPLKVNMAGVIPAIFASSILLFPASLGSWFGQSEGMGWLQD
IAQAIAPGQPLNILLFSVGIIFFCFFYTALMFNPKDVAENLKKSGAFIPGIRPGEQSARY
IDGVLTRLTIFGALYMTAVCLLPQFLVVAANVPFYLGGTSLLIVVVVVMDFMSQVQSHLV
SHQYESLMKKSNLKGYGGGMLR
NT seq 1329 nt   +upstreamnt  +downstreamnt
atggctaagcaaggtgctctctccgcactcagcaatggcgggctgtccgagctctgggct
cggctgcggttcctgttcctggcgatcatcgtctatcgcataggcgcgcatatcccggtg
ccaggaatcaatcccgacaggctggcggaactgttccagcagaacgagggaaccattctt
agcctgttcaacatgttctccggtggcgcgctggagcggatgagcatctttgcgctgggg
atcatgccgtatatttcggcatcgatcatcatgcagctgatgaccgtggtcagcccccag
ctggagcagttgaagaaggagggcgaggccggtcgtcgcaagatcagccagtacacccgc
tacgggacacttgttctggcgattatccaggccttcggcatgtccgtcggtctggccagt
cagggcgtcgccttcgccgccgatttcagcttccacttcgtggctgtgaccaccttcgtg
gctggtgcgatgttcatgatgtggctgggtgagcagattaccgagcgaggcgtcggcaat
ggcatctcgatgctgatctttgccgggatcgtggccggtctgccggcagcgatcggtcag
tcgttcgagtctgcccgtcagggcgatatcaatatcattgctctgctgtctgtcgcgctg
ctggctgtagcgatcatcggcttcgtggttttcgtcgagcgtggccagcgacgtattgcg
gtgcactatgccaagcgtcagcagggtcgcaaggtttttgctgcgcagaccagccacttg
ccgctgaaggtgaatatggcgggggtcattccggccattttcgctagcagcatcctgctg
ttcccagcttcgctggggtcctggtttggtcagtcggaaggcatgggctggctgcaggac
attgcccaggccatcgcgcccggtcagccattgaatatcctcctgttcagtgtggggatc
attttcttctgcttcttctacactgcgctgatgttcaatcccaaggatgtggcggaaaac
ctgaaaaaatcgggcgctttcattccgggcatcaggccgggtgagcagtcggcgcgctat
atcgatggtgtgctgacccgcttgaccatttttggcgctctctacatgacggcggtctgt
ctgctcccacagttcctggtggtggcagccaacgtgccgttctatcttggcgggacttcg
ttgctgatcgtggtggtggttgtgatggacttcatgtcgcaagtacaatcgcacctcgtt
tcgcaccagtacgaatccctgatgaagaaaagcaacctgaagggctatggcggcggcatg
ctccgctga

DBGET integrated database retrieval system