KEGG   Azotobacter chroococcum: Achr_36090
Entry
Achr_36090        CDS       T03640                                 
Symbol
gspL
Name
(GenBank) general secretion pathway protein L
  KO
K02461  general secretion pathway protein L
Organism
acx  Azotobacter chroococcum
Pathway
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_36090 (gspL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_36090 (gspL)
Secretion system [BR:acx02044]
 Type II secretion system
  General secretion pathway protein
   Achr_36090 (gspL)
SSDB
Motif
Pfam: T2SSL GspL_C Ferritin_2 TMF_TATA_bd
Other DBs
NCBI-ProteinID: AJE23004
UniProt: A0A0C4WQR8
LinkDB
Position
4018994..4020151
AA seq 385 aa
MNEFLLVSLGPRPEAPVEWLVWNPDEARCVDAGQLAHADELPQLAQLARTHPCYALLPQE
QVLVTEVRLPNASRAARRTIPYQLEEQLCDDPALLHFAVGSPRADHRYPVAVVARTLIES
WRDRLRAASIPARALFADAQSLRCDPERLIATPLGERLLINGAGLAGLAFASAELASWRP
LLERHGVLETLPAAPDDPPLAALAARLSPEQAIDLLQGEYRLQDAPGTRLRQLRIPAVLG
LLALILGFAALGLENHRLARQKEALDRQVVELFREAFPEVQRIVDPRTQLEQRLDELRQR
RQGSRFLHLLEKSVPAFRQHGAVRVTGMHYAEDDRRLELELQAAEQPAFERFAAALEQNG
LRARLGQVQKRQQDTTAQMAVEGID
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgaatgaatttctgctggtgagtctcgggccgcggcccgaggcgcccgtcgagtggctg
gtctggaacccggacgaggcccgctgcgtcgacgccggacagctcgcccatgccgacgag
cttccccagctggcgcaactggcccgtacccatccctgttatgcgctgctgccccaggag
caggtgctggtgaccgaagtccggctgcccaacgccagccgcgccgcccggcggacgata
ccctaccagctcgaagaacaactctgcgacgacccggccctgctgcatttcgcggtgggc
agtccgcgcgcggaccaccgctacccggtggcggtcgtcgcgcgcacgctgatcgagtcc
tggcgcgaccgcttgcgcgcggcatcgatcccggccagggcgctgttcgccgatgcccag
agcctgcgctgcgacccggagcgactgatcgcgacgcccctgggcgaacgcctgctgatc
aacggcgccggactggccggcctggcgttcgccagcgcggaactggcgagctggcgaccg
ctcctggagcggcacggcgtcctggaaacgctgcccgccgcgccggacgacccgccactg
gcggcgctggccgcgcgcctgtcgcccgagcaggccatcgacctgctgcagggcgagtac
cggctgcaggatgcgcccggaacacggctgcgtcagctgaggattcccgcggtgctgggc
ctgctggcgctgatcctgggcttcgccgccctgggcctcgaaaaccatcggctggcccgc
cagaaggaagcgctcgaccggcaggtcgtcgagctgttccgcgaggcctttccggaggtg
cagcgaatcgtcgatccgcggacccagctggagcagcggctcgacgaactgcgccaacgc
cggcagggctcgcgctttctgcacctgctggaaaagagcgtcccggcctttcgccagcac
ggcgccgtcagggtgaccggcatgcactatgcggaagacgaccggcgcctggagctggaa
ctgcaggcggccgagcagcccgccttcgagcgcttcgccgccgcgctggagcagaacgga
ctgcgggcccggctcggccaggtgcagaagcgccagcaagacaccaccgcccagatggcc
gtggagggaatcgattaa

DBGET integrated database retrieval system