KEGG   Azotobacter chroococcum: Achr_3860
Entry
Achr_3860         CDS       T03640                                 
Symbol
ptsP
Name
(GenBank) Phosphoenolpyruvate-protein phosphotransferase PtsP
  KO
K08484  phosphotransferase system, enzyme I, PtsP [EC:2.7.3.9]
Organism
acx  Azotobacter chroococcum
Pathway
acx02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    Achr_3860 (ptsP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_3860 (ptsP)
Enzymes [BR:acx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     Achr_3860 (ptsP)
Transporters [BR:acx02000]
 Phosphotransferase system (PTS)
  Enzyme I and HPr
   Enzyme I [TC:8.A.7]
    Achr_3860 (ptsP)
SSDB
Motif
Pfam: PEP-utilizers_C PEP-utilisers_N PEP-utilizers GAF GAF_2 GAF_3 Sec8_exocyst DUF4763
Other DBs
NCBI-ProteinID: AJE19892
UniProt: A0A0C4WP52
LinkDB
Position
413924..416203
AA seq 759 aa
MLNTLRKIVQEVNAAKDLKTALGIIVRRVKETMGSQVCSVYLLDPETNRFVLMATEGLNK
RSIGKVSMASNEGLVGLVGTREEPLNLENAADHPRYRYFAETGEERYASFLGAPIIHHRR
VMGVLVIQQKERREFDEGEEAFLVTMSAQLAGVIAHAEATGSIRGLGRQGKGIQEARFIG
VPAAPGVAVGKAVVVLPPADLEVVPDRPTEDVKAELELFHSALESVRADIRALSAKLATQ
LRPEERALFDVYLMMLDDASLGCEVQRVIKTGQWAQGALRQVVSEHIKRFELMDDAYLRE
RASDVKDLGRRLLAYLQQARQQTMVYAENTILVSEELSPAMLGELPEGKLVGLVSVQGSG
NSHVAILARAMGIPTVMGVVDLPYSKMDGIDLIVDGYHGEVYTNPSELLRQQFAELVEEE
RQLTQGLDALRELPCETLDGHRLPLWVNTGLLADVARAQERGAEGVGLYRTEVPFMNNER
FPSEKEQLAIYRDQLSAFHPLPVTMRTLDIGGDKALSYFPIKESNPFLGWRGIRVTLDHP
EIFLVQVRAMLKASEGLNNLRILLPMISSIHELDEALHLIHRAWGEVRDEGTDVPMPPIG
VMVEIPAAVYQTREISRLVDFLSVGSNDLTQYLLAVDRNNPRVADLYDYLHPAVLQALYK
VVQDAHGEGKPVSICGEMAGDPSAAVLLMAMGFDSLSMNATNLPKVKWLLRQVTLSKAKE
LLGQLMAIDNPQVIHSTLQLALRNLGLGRVINPVASLQG
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgctcaacacgctgcgcaagatcgtccaggaagtgaatgccgccaaggatctcaagacg
gcactgggcatcatcgtgcgtcgcgtcaaggagaccatgggcagccaggtctgctcggtc
tacctcctcgatccggaaaccaaccgcttcgtgctgatggccaccgaggggctcaacaag
cgctccatcggcaaggtcagcatggcctccaacgagggcctggtcggcctggtcggcacc
cgcgaggagccgctcaacctggagaacgcggccgaccacccccgctaccgctacttcgcc
gagaccggcgaggagcgctacgcctccttcctcggcgcaccgatcatccaccaccggcgg
gtgatgggcgtgctggtcatccagcagaaggagcgccgcgagttcgacgagggcgaggaa
gccttcctggtgaccatgagcgcgcagctcgccggggtcatcgcccatgccgaggcgacc
ggctcgatccgcggcctcggccggcagggcaagggcatccaggaggcgcgcttcatcggc
gtgccggccgcaccgggcgtcgccgtcggcaaggccgtggtggtgctaccgccggccgac
ctggaggtggtgccggacaggccgacggaggacgtcaaggccgagctggaactgttccac
agcgccctggagtcggtgcgcgccgacatccgcgcgctgtccgccaaactggccacccag
ttgcgcccggaagagcgcgcgctgttcgacgtctacctgatgatgctcgacgacgcctcg
ctgggctgcgaggtgcagcgggtgatcaagaccggccagtgggcccagggcgccctgcgc
caggtggtcagcgagcacatcaagcgcttcgagctgatggacgacgcctacctgcgcgag
cgcgcctccgacgtcaaggacctcggccggcgcctgctcgcctacctgcagcaggcccgc
cagcagaccatggtctatgcggagaacaccatcctggtcagcgaggagctgagcccggcg
atgctcggcgagctgcccgagggcaagctggtcggcctggtctcggtgcagggctcgggc
aactcccacgtggcgatcctcgcccgtgccatgggcattcccacggtgatgggggtggtc
gacctgccctattcgaagatggacggcatcgacctgatcgtcgacggctaccatggcgag
gtctacaccaatcccagcgagctgctgcgccagcagttcgccgagctggtcgaggaggag
cgccagctgacccagggcctggacgccctgcgcgagctgccctgcgagaccctcgacggc
caccgcctgccgctgtgggtcaacaccgggctgctcgccgatgtcgcccgcgcccaggag
cgcggcgccgagggggtgggcctgtaccgcaccgaagtgccgttcatgaacaacgagcgc
ttccccagcgagaaggagcagctggcgatctaccgcgaccagctgtccgccttccatccg
ctgccggtgaccatgcgcaccctggacatcggcggcgacaaggcgctgtcctacttcccg
atcaaggaaagcaaccccttcctcggctggcgcggcatccgcgtcaccctcgaccacccg
gaaatcttcctggtgcaggtccgcgccatgctcaaggccagcgaggggctgaacaacctg
cgtatcctgctgccgatgatctcctcgatccacgagctggacgaggcgctgcacctgatc
caccgcgcctggggcgaggtccgcgacgagggcaccgacgtgccgatgccgccgatcggg
gtgatggtggagattcccgcggcggtctaccagacccgcgagatctcccggctggtggat
ttcctttcggtcggctccaacgacctgacccagtacctgctggcggtggaccgcaacaac
ccgcgggtcgccgacctctacgactatctgcatccggccgtgctgcaggcgctctacaag
gtggtgcaggatgcccatggcgaaggcaaaccggtgagcatctgcggtgagatggccggc
gatccctcggcggcggtgctgctgatggccatgggcttcgacagcctgtcgatgaacgcc
accaacctgcccaaggtcaagtggctgctgcgccaggtcaccctgagcaaggccaaggag
ctgctcggccagctgatggccatcgacaatccgcaggtcatccacagcacgctgcagctg
gccctgcgcaacctcggcctcggccgggtgatcaatccggtggcttcgctgcaggggtga

DBGET integrated database retrieval system