KEGG   Azotobacter chroococcum: Achr_39960
Entry
Achr_39960        CDS       T03640                                 
Name
(GenBank) methyl accepting chemotaxis sensory transducer
  KO
K05874  methyl-accepting chemotaxis protein I, serine sensor receptor
Organism
acx  Azotobacter chroococcum
Pathway
acx02020  Two-component system
acx02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Achr_39960
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Achr_39960
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:acx02035]
    Achr_39960
Bacterial motility proteins [BR:acx02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Achr_39960
SSDB
Motif
Pfam: MCPsignal HAMP TarH Fib_alpha Serine_rich AI-2E_transport Neurensin DUF6278 Tweety DUF948 SKA1
Other DBs
NCBI-ProteinID: AJE23382
UniProt: A0A0C4WWQ6
LinkDB
Position
4472887..4474590
AA seq 567 aa
MEIFMLGFLRNLSIRAIVTTTLACFALLIGIIAALGYTGTDMANQALEDRTRTATRIDLL
RQIDRLSLKVFAHLEAYGKMSAVGLVGMVERQGQQAELRELLGTARTSLADFKAMPPFAR
EDGRQLLETVAGDLDESLAALDRQLQAWVEQDTDTYDQLEDEMIFKRGPQVARDLADTLA
YLETHGARQLADYHASLTAFAIVGGLALGLALLLMLGLRAMLLGFVVRPVSEAAEHVQRL
ARADLSQPIPVASGNEIGQLLGALREMQDSLVRIVGSVRAGSGSILVGAQEIAGGNADLS
SRTEQQAASLEETAASMEELTATVKQNADNARQASALANDASGTAGQGREVVGRVVETMR
EISDSSQQIARIVGVIDSIAFQTNILALNASVEAARAGEQGRGFAVVAGEVRNLAGRSAE
AAREIKTLIEASTKRVGDGSQLVEQAGKTMEEVVRSVQRVTDIIDEISAASHEQSEGIAQ
VNTAIAQMDEVTQQNAALVQEASASLAGQARHLEEAVAVFRLGAGQEARAARSDTAQSHS
GEQHRLAVAKEPARPALAVAEERWEAF
NT seq 1704 nt   +upstreamnt  +downstreamnt
atggagattttcatgttgggtttcttgcgcaacctgagcatcagggcgatcgtcaccacc
accctggcctgtttcgcgctcttgatcggcatcatcgccgcgctgggctacaccggcacc
gatatggccaaccaggcgctcgaggaccggacacggaccgccacccgcatcgacctgctg
cgccagatcgacaggctgagcctgaaggtcttcgcgcacctggaggcctacggcaagatg
agcgccgtcggcctggtcggcatggtggagcggcaggggcagcaggccgaactccgggaa
ctgctcggcacggcccgcacatccctggcggacttcaaggccatgccgccgttcgcccgg
gaggacgggcgccagttgctggaaacggttgccggcgacctggacgagagcctggcggcg
ctcgacaggcagctgcaggcctgggtcgagcaggacaccgacacctacgaccagctcgag
gacgagatgatcttcaagcgcggtccccaggtcgccagggatctggccgataccctggcc
tacctcgaaacccatggcgcacggcagctggccgattatcacgccagtctcaccgccttc
gccatcgtcggcggcctcgcgctgggcctcgccctgctgctgatgctggggctgcgggcg
atgctgctgggcttcgtggtcaggccggtgagcgaggcggcggagcacgtacagcgcctg
gcgcgggcggacctgtcgcagccgatcccggtggcctcgggcaacgagatcggccagttg
ctgggcgcgctgcgcgagatgcaggacagcctggtgcggatcgtcggcagcgtgcgcgcc
ggcagcggctcgatcctggtcggcgcgcaagagatcgccggcggcaacgccgacctgtcc
tcgcgcaccgagcagcaggccgcctcgctggaggaaaccgcggcgagcatggaggagctg
accgcgacggtgaagcagaatgccgacaacgcccgccaggccagcgcgctggccaacgac
gcatcgggcaccgccgggcagggccgcgaagtggtcggccgggtggtggagaccatgcgc
gagatcagcgacagctcgcagcagatcgcgcggatcgtcggggtgatcgactcgatcgcc
ttccagaccaacatcctggcgctgaacgcctcggtggaggcggcgcgtgccggcgagcag
ggccgcggcttcgcggtggtggccggcgaggtgcgcaacctggcggggcgctcggcggag
gcggcgcgggagatcaagacgctgatcgaggcctcgaccaagcgggtcggcgacggctcg
caactggtcgagcaggcgggcaagaccatggaggaagtggtcaggtcggtgcagcgggtg
accgacatcatcgacgagatctcggcggcctcgcacgagcagagcgagggcatcgcccag
gtgaacacggcgatcgcgcagatggacgaggtgacgcagcagaacgcggcgctggtgcag
gaggcgtcggcctcgctggccgggcaggcgcggcatctggaggaggcggtggcggtgttc
cggctgggcgcagggcaggaagcccgggcggcgcggagcgacacggcgcaatcccactca
ggggagcagcacaggctggccgtggcgaaggaacctgccaggccggccctggccgtcgcc
gaggagcgctgggaagccttctga

DBGET integrated database retrieval system