KEGG   Azotobacter chroococcum: Achr_6430
Entry
Achr_6430         CDS       T03640                                 
Symbol
tatA
Name
(GenBank) Sec-independent protein translocase protein TatA (Precursor)
  KO
K03116  sec-independent protein translocase protein TatA
Organism
acx  Azotobacter chroococcum
Pathway
acx03060  Protein export
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Achr_6430 (tatA)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_6430 (tatA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_6430 (tatA)
Secretion system [BR:acx02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein
   Achr_6430 (tatA)
SSDB
Motif
Pfam: TatA_B_E DUF2207 LptF_LptG
Other DBs
NCBI-ProteinID: AJE20142
UniProt: A0A0C4WPR0
LinkDB
Position
complement(704224..704457)
AA seq 77 aa
MGFGGISIWQLLIILLIVVMLFGTKRLKSLGSDLGDAIKGFRKSMDNEENKAPPVEEQKG
QTIEAQARKVEEPARKD
NT seq 234 nt   +upstreamnt  +downstreamnt
atgggttttggcggtatcagcatctggcaacttctgatcatcctgctcatcgtcgtcatg
ctgttcggcaccaagcgcctgaagagccttggctcggacctgggcgatgcgatcaagggc
ttccgcaagtcgatggacaacgaggagaacaaggcgccgcccgtcgaagagcagaaaggc
cagaccatcgaggcccaggcccgcaaggtcgaggaaccggccaggaaagactga

DBGET integrated database retrieval system