KEGG   Azotobacter chroococcum: Achr_6530
Entry
Achr_6530         CDS       T03640                                 
Symbol
argS
Name
(GenBank) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
acx  Azotobacter chroococcum
Pathway
acx00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:acx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Achr_6530 (argS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acx01007]
    Achr_6530 (argS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acx03016]
    Achr_6530 (argS)
   03029 Mitochondrial biogenesis [BR:acx03029]
    Achr_6530 (argS)
Enzymes [BR:acx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     Achr_6530 (argS)
Amino acid related enzymes [BR:acx01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Achr_6530 (argS)
Transfer RNA biogenesis [BR:acx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Achr_6530 (argS)
 Prokaryotic type
   Other AARSs
    Achr_6530 (argS)
Mitochondrial biogenesis [BR:acx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Achr_6530 (argS)
SSDB
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1e
Other DBs
NCBI-ProteinID: AJE20152
UniProt: A0A0C4WPR7
LinkDB
Position
complement(711830..713569)
AA seq 579 aa
MKDTIRQLIQQALTRLTDDGVLPAGLTPAIQVENSKDKSHGDFASNIAMMLAKPAGLKPR
ELAEKLIAALPPSASISKVEIAGPGFLNFFQNSDALAQRLQRALADERLGVRKHGDLQRV
VVDLSSPNLAKEMHVGHLRSTIIGDAVARVLEFLGDTVIRQNHVGDWGTQFGMLLAHLEE
NPASAESELADLEQFYRAAKKRFDDSEAFADRARELVVKLQAGDAECLRLWQRFNEVSLS
HCQEVYERLGVRLSADDIRGESAYNDELPGVVQALRDKGLLTESDGAQCVFLDEFKNAEG
NPLPVIVQKAGGGYLYATTDLAAMRYRSKVLEADRVLYFVDQRQALHFQMAFAVARRAGF
VHEGTDLEHMGFGTMNGADGRPFKTRDGGTVKLIDLLDEAEQRAYALVKGKNPELPEDEL
RSIARAVGIGAVKYADLSKHRTSDYSFNFELMLSFEGNTAPYLLYAYTRVASVFRKLGKG
FAEIDGNLALEAEQEQALAARLAQFGEVLGNVAEKGLPHLLCAYLYDLAGLFSSFYENCP
ILAADTPARQQSRLLLAALTGRTLRQGLELLGLETLERM
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgaaagacacgattcgccagctgatccagcaagccctgacccgcctgaccgatgacggc
gtgctccccgcgggcctgacgccggcgatccaggtggaaaacagcaaggacaagagccac
ggcgacttcgccagcaacatcgccatgatgctggccaagccggccgggctgaagccgcgc
gagctggccgagaagctgatcgccgcgttgccgcccagtgcctcgatcagcaaggtggaa
atcgccggcccgggctttctcaacttcttccagaacagcgatgccctggcccagcgcctg
cagcgggcgctggccgacgagcgcctcggggtgcgcaagcacggcgacctgcagcgcgtg
gtggtcgacctgtcctcgcccaatctggccaaggagatgcacgtcggccacctgcgctcg
accatcatcggcgatgccgtggcgcgggtgctggagttcctcggcgacaccgtgatccgc
cagaaccacgtcggcgactggggcacccagttcggcatgctgctggcccacctggaggag
aacccagcctccgccgagagcgagctggccgacctcgaacagttctaccgcgccgcgaag
aagcgcttcgacgactccgaggccttcgccgaccgcgcccgcgaactggtggtcaagctg
caggccggcgatgcggaatgcctgcgcctgtggcagcgcttcaacgaggtctctctgtcg
cactgccaggaagtctacgagcgcctcggcgtgcgcctgagcgcggacgacatccgcggc
gagagcgcctacaacgacgagctgccgggcgtcgtccaggccctgcgcgacaagggcctg
ttgaccgagagcgacggcgcccagtgcgtgttcctcgacgagttcaagaatgccgagggc
aacccgctgccggtgatcgtgcagaaggccggcggcggctatctgtacgccaccaccgac
ctcgccgcgatgcgctaccgcagcaaggtgctcgaggccgaccgcgtgctctacttcgtc
gaccagcgccaggccctgcacttccagatggccttcgcggtggcgcgccgcgccggcttc
gtgcacgagggcacggacctcgagcacatgggtttcggcaccatgaacggcgccgacggt
cgcccgttcaagacccgcgacggcggcacggtgaagctgatcgacctgctcgacgaggcc
gaacagcgcgcctacgctctggtcaagggcaagaatccggagctgcccgaggacgagctg
cgcagcatcgcccgcgcggtcggcatcggtgcggtgaagtacgccgacctgtccaagcac
cgcaccagcgactacagcttcaacttcgagctgatgctgagcttcgagggcaacaccgcg
ccctacctgctctacgcctacacccgcgtggccagcgtgttccgcaagctgggcaagggc
ttcgccgagatcgacggcaacctcgccctcgaggccgaacaggagcaggcgctggccgcc
cggctggcgcagttcggcgaggtgctcggcaacgtcgccgagaagggcctgccgcacctg
ctttgcgcctacctctatgatctggccggactgttctccagcttctacgagaactgcccg
atcctcgctgccgacactccggcccgccagcagagccgcctgctgctggccgcgctgacc
ggccgcaccctccggcagggcctggaactgctcggcctggaaaccctggaacgcatgtaa

DBGET integrated database retrieval system