KEGG   Azotobacter chroococcum: Achr_9450
Entry
Achr_9450         CDS       T03640                                 
Name
(GenBank) Hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
acx  Azotobacter chroococcum
Pathway
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_9450
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:acx02044]
    Achr_9450
Secretion system [BR:acx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Achr_9450
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AJE20427
UniProt: A0A0C4WQ90
LinkDB
Position
complement(1044767..1045285)
AA seq 172 aa
MPTPAYLSLEGTKQGLITAGTFTEDSVGNIFQEGHEDQILVQAFNHQVIIPRDPQSGQPT
GQRVHKPLMITKVFDKSSPLIFNALTSGERLAKCRLEWFRTSATGTQEHYFTIELEDAVI
VDVQSRMPNCQDPNMAHFTHLEDVYFTYRKIVWTHEVSGTSGSDDWRTPISA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaacacccgcgtacctgtccctcgaaggcaccaagcagggcctgatcaccgccggc
accttcaccgaggattcggtcggcaacatcttccaggaaggccacgaggaccagatcctg
gtccaggccttcaaccaccaggtgatcattccccgcgacccgcagtccggccagcccacc
ggccagcgggtgcacaagccgctgatgatcaccaaggtgttcgacaagtcctcgccgctg
atcttcaacgccctcacctccggcgagcgcctggccaagtgccgcctggagtggttccgc
acctcggccaccggcacccaggagcactacttcaccatcgagctggaggatgcggtgatc
gtcgacgtgcagtcgcgcatgccaaattgccaggacccgaatatggcgcactttacccat
ctggaagacgtctacttcacctaccgcaagatcgtctggacccacgaggtgtccggcacc
tccggctccgacgactggcgcacgccgatctccgcctga

DBGET integrated database retrieval system