Anabaena cylindrica: Anacy_4170 Help Entry Anacy_4170        CDS       T02435                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism acy  Anabaena cylindrica Pathway acy00998   Biosynthesis of various antibiotics acy01100   Metabolic pathways acy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:acy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Anacy_4170    00074 Mycolic acid biosynthesis     Anacy_4170   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Anacy_4170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF6137 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AFZ59536 UniProt:  K9ZK02 LinkDB All DBs Position 4692513..4692764 Genome browser AA seq 83 aa AA seqDB search MSQADIFERVKKVIVEQLDADTDKVEPNASFTDDLGADSLDIVELVMALEEEFDIEIPDE AAEKILTVQEVVDYISNNVAASA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagccaagcagatatttttgaaagggttaaaaaggtcatcgttgagcaactagacgct gatactgataaagttgaaccaaatgcttcatttacagatgatttaggggctgattcccta gatatcgtggaactggtaatggctttggaagaagaatttgacatcgaaattcctgatgaa gctgccgaaaagattttaacggttcaagaggtagtagactacatcagcaataacgttgct gcgtctgcctaa

DBGET integrated database retrieval system