Anser cygnoides (swan goose): 106037999 Help Entry 106037999         CDS       T04896                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism acyg  Anser cygnoides (swan goose) Pathway acyg04137   Mitophagy - animal acyg04140   Autophagy - animal acyg04144   Endocytosis acyg04145   Phagosome acyg04148   Efferocytosis acyg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:acyg00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106037999 (RAB7A)    04145 Phagosome     106037999 (RAB7A)    04140 Autophagy - animal     106037999 (RAB7A)    04137 Mitophagy - animal     106037999 (RAB7A)    04148 Efferocytosis     106037999 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106037999 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:acyg04131]     106037999 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acyg04147]     106037999 (RAB7A)    04031 GTP-binding proteins [BR:acyg04031]     106037999 (RAB7A) Membrane trafficking [BR:acyg04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     106037999 (RAB7A) Exosome [BR:acyg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106037999 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    106037999 (RAB7A)   Exosomal proteins of colorectal cancer cells    106037999 (RAB7A)   Exosomal proteins of bladder cancer cells    106037999 (RAB7A) GTP-binding proteins [BR:acyg04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     106037999 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 G-alpha AAA_5 AAA_24 ATPase_2 NB-ARC AAA_14 NACHT ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  106037999 NCBI-ProteinID:  XP_066858985 UniProt:  A0A8B9EQC3 LinkDB All DBs Position 10:14532204..14550720 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRVKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttctaggaagaaagtgttactgaaagtcatcatccttggagactccggggtggga aagacatcgctcatgaaccagtatgtgaacaagaaattcagtaaccagtacaaggctacg ataggtgcagacttcctgacaaaagaagtcatggtggatgacaggctagtgacaatgcag atatgggatacagcaggacaagaacggtttcagtctctgggagttgccttctacagggga gcagactgctgtgtgctggtgttcgatgtcacggcccctaacacgttcaaaaccctagac agctggagggatgaattcctcattcaggccagtccaagggatcctgagaactttcctttt gttgtgctgggaaacaagattgacctagaaaacagacaagtcaccacaaaacgggcgcaa gcctggtgctacagtaaaaacaacatcccctactttgaaaccagtgccaaggaggccatt aatgtggaacaagctttccagacgattgcacgaaatgcacttaaacaggaaaccgaagtg gagctttacaatgaattccccgaacccatcaaactagacaagaatgaccgagtgaaggct tctgcggagagctgcagctgctga

DBGET integrated database retrieval system