Anser cygnoides (swan goose): 106041320 Help Entry 106041320         CDS       T04896                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism acyg  Anser cygnoides (swan goose) Pathway acyg04010   MAPK signaling pathway acyg04012   ErbB signaling pathway acyg04068   FoxO signaling pathway acyg04137   Mitophagy - animal acyg04140   Autophagy - animal acyg04150   mTOR signaling pathway acyg04210   Apoptosis acyg04218   Cellular senescence acyg04370   VEGF signaling pathway acyg04371   Apelin signaling pathway acyg04540   Gap junction acyg04625   C-type lectin receptor signaling pathway acyg04810   Regulation of actin cytoskeleton acyg04910   Insulin signaling pathway acyg04912   GnRH signaling pathway acyg04916   Melanogenesis Brite KEGG Orthology (KO) [BR:acyg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106041320 (NRAS)    04012 ErbB signaling pathway     106041320 (NRAS)    04370 VEGF signaling pathway     106041320 (NRAS)    04371 Apelin signaling pathway     106041320 (NRAS)    04068 FoxO signaling pathway     106041320 (NRAS)    04150 mTOR signaling pathway     106041320 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106041320 (NRAS)    04137 Mitophagy - animal     106041320 (NRAS)   09143 Cell growth and death    04210 Apoptosis     106041320 (NRAS)    04218 Cellular senescence     106041320 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     106041320 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     106041320 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106041320 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     106041320 (NRAS)    04912 GnRH signaling pathway     106041320 (NRAS)    04916 Melanogenesis     106041320 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:acyg04131]     106041320 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acyg04147]     106041320 (NRAS)    04031 GTP-binding proteins [BR:acyg04031]     106041320 (NRAS) Membrane trafficking [BR:acyg04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     106041320 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     106041320 (NRAS) Exosome [BR:acyg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106041320 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    106041320 (NRAS)   Exosomal proteins of breast cancer cells    106041320 (NRAS)   Exosomal proteins of colorectal cancer cells    106041320 (NRAS) GTP-binding proteins [BR:acyg04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     106041320 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  106041320 NCBI-ProteinID:  XP_066839302 LinkDB All DBs Position 25:complement(6850125..6855076) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSEDGNQG CMGLSCIVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtggtgggagccggcggcgtcggcaagagcgcgctgacc atccagctcatccagaaccacttcgtggacgagtacgaccccaccatcgaggactcatac agaaagcaggttgttattgatggagagacatgcttgttagatattctggatactgcagga caggaagaatatagtgctatgcgtgatcagtacatgagaactggggaaggattcctctgc gtgtttgccattaacaacagtaaatcatttgctgatattaacctttacagagagcaaatc aagagagtgaaagattcagatgatgtgccaatggttctggttgggaataagtgtgatttg cccacaagaacagtagacacaaaacaggcccaagaattagcaaaaagctatggaatcccc tttatagagacatctgctaaaacaagacagggtgttgaagacgctttttacacgctggtg agagagatccggcaataccggatgaaaaagctcaacagcagtgaagatgggaatcaaggc tgcatgggattgtcctgcattgtgatgtga

DBGET integrated database retrieval system