Anser cygnoides (swan goose): 106042165 Help Entry 106042165         CDS       T04896                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism acyg  Anser cygnoides (swan goose) Pathway acyg04814   Motor proteins acyg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:acyg00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     106042165 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106042165 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:acyg03037]     106042165 (DYNLT3)    04812 Cytoskeleton proteins [BR:acyg04812]     106042165 (DYNLT3) Cilium and associated proteins [BR:acyg03037]  Motile cilia and associated proteins   Dynein arm    106042165 (DYNLT3) Cytoskeleton proteins [BR:acyg04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      106042165 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  106042165 NCBI-ProteinID:  XP_013046400 LinkDB All DBs Position 1:121538671..121545834 Genome browser AA seq 116 aa AA seqDB search MEDFHPHNDEMIFNADEAHNIVKECIESVLGKADYNHNKVNQWTAAIVEQSLTHLVKLGK TYKYIVTCAVMQRSGAGLHTASSCFWDTTTDGTCTVRWENRTMNCIVNVFAVAIIL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggactttcacccccacaacgacgagatgatcttcaacgctgatgaggcccacaac atagttaaggagtgcatagaaagtgtcttgggcaaggcagattataatcacaacaaagtc aaccagtggactgcagctatagtagagcagtcgctgacacatttggtaaagcttgggaaa acatacaagtacatcgtaacttgtgcagtgatgcagaggagtggagctggtctacacaca gcaagctcatgtttctgggataccacaactgatggaacttgcacagtgagatgggaaaac cgaacaatgaactgcattgtgaatgtgtttgctgttgctattatcctgtag

DBGET integrated database retrieval system