Anser cygnoides (swan goose): 106042601 Help Entry 106042601         CDS       T04896                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism acyg  Anser cygnoides (swan goose) Pathway acyg04010   MAPK signaling pathway acyg04068   FoxO signaling pathway acyg04081   Hormone signaling acyg04114   Oocyte meiosis acyg04140   Autophagy - animal acyg04150   mTOR signaling pathway acyg04810   Regulation of actin cytoskeleton acyg04910   Insulin signaling pathway acyg04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:acyg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106042601 (INS)    04068 FoxO signaling pathway     106042601 (INS)    04150 mTOR signaling pathway     106042601 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     106042601 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106042601 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     106042601 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     106042601 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     106042601 (INS)    04914 Progesterone-mediated oocyte maturation     106042601 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:acyg04052]     106042601 (INS) Cytokines and neuropeptides [BR:acyg04052]  Neuropeptides   Unclassified    106042601 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  106042601 NCBI-ProteinID:  XP_013047074 UniProt:  A0A8B9DA51 LinkDB All DBs Position 5:38311576..38315135 Genome browser AA seq 107 aa AA seqDB search MALWIRSLPLLALLALSGPGISHAAANQHLCGSHLVEALYLVCGERGFFYSPKTRRDIEQ PLVSGPLHGEVGELPFQHEEYQKVKRGIVEQCCENPCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatccggtcgctgcctctcctggcccttctcgctctttctggccctggg atcagccacgcggctgccaaccagcacctctgtggctcccacttggttgaggctctctac ctggtgtgtggagagcggggtttcttctactcccccaaaacccgacgggacattgagcag cctctagtgagtggtcccctgcatggcgaggtgggagagctgccgttccaacatgaggaa taccagaaagtcaagcgaggcattgttgagcaatgctgtgaaaacccatgctccctctac caactggaaaactactgcaactag

DBGET integrated database retrieval system