Anser cygnoides (swan goose): 125181113 Help Entry 125181113         CDS       T04896                                  Symbol UBL5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism acyg  Anser cygnoides (swan goose) Brite KEGG Orthology (KO) [BR:acyg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:acyg03041]     125181113 (UBL5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:acyg04052]     125181113 (UBL5) Spliceosome [BR:acyg03041]  Complex B   Other components    Complex B specific factors     125181113 (UBL5) Cytokines and neuropeptides [BR:acyg04052]  Neuropeptides   Unclassified    125181113 (UBL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 DUF5343 Motif Other DBs NCBI-GeneID:  125181113 NCBI-ProteinID:  XP_066842525 LinkDB All DBs Position 34:complement(571873..574028) Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTEDSIRDLKKLIAAQTGTRWDKIVLKKWYTIFKDHVTLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaagtcgtttgcaacgaccgcttgggcaagaaggtgcgggtgaaatgcaacacc gaggactccatccgcgacctgaagaagctcatcgcggcgcagacggggacccgctgggac aagatcgtgctcaagaagtggtacaccatcttcaaggaccacgtcacgctcggggactat gagatccacgacggcatgaacctggagctgtactaccagtag

DBGET integrated database retrieval system