Anser cygnoides (swan goose): 125184635 Help Entry 125184635         CDS       T04896                                  Name (RefSeq) metallothionein-1   KO K14739   metallothionein 1/2 Organism acyg  Anser cygnoides (swan goose) Brite KEGG Orthology (KO) [BR:acyg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:acyg03019]     125184635    03029 Mitochondrial biogenesis [BR:acyg03029]     125184635 Messenger RNA biogenesis [BR:acyg03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      125184635 Mitochondrial biogenesis [BR:acyg03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     125184635 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  125184635 NCBI-ProteinID:  XP_047934716 UniProt:  A0A8B9INS7 LinkDB All DBs Position 12:complement(13653958..13655169) Genome browser AA seq 63 aa AA seqDB search MDSQDCPCATGGTCTCGDNCKCKNCKCTSCKKGCCSCCPAGCAKCAQGCVCKGPPSAKCS CCK NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atggactcccaggactgcccttgcgccaccggtggcacctgcacctgcggggacaactgc aaatgtaaaaactgcaaatgcacgtcgtgcaaaaaaggctgctgctcctgctgccccgcg ggatgtgccaagtgcgcgcagggctgcgtctgcaaagggcccccctccgccaagtgcagc tgctgcaagtag

DBGET integrated database retrieval system