Anser cygnoides (swan goose): 136788093 Help Entry 136788093         CDS       T04896                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism acyg  Anser cygnoides (swan goose) Pathway acyg04382   Cornified envelope formation acyg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:acyg00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     136788093 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     136788093 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acyg04147]     136788093 (S100A10) Exosome [BR:acyg04147]  Exosomal proteins   Exosomal proteins of microglial cells    136788093 (S100A10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen STAT_linker Motif Other DBs NCBI-GeneID:  136788093 NCBI-ProteinID:  XP_066842045 LinkDB All DBs Position 33:complement(544076..545775) Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETLMFTFHKYAGDKNHLSKEDLRVLMEKEFPGFLENQRDPMALDKIMKDLD QCRDGKVGFQSFFSLVAGLTIACNDYFVVHMKQKGRK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtcccagatggagcacgccatggagacgctgatgttcaccttccacaagtacgcg ggggacaagaaccacctgagcaaggaggacctgcgggtgctgatggagaaggagttcccc ggcttcttggagaaccaacgcgacccgatggcgctggacaagatcatgaaggacctggac cagtgccgcgacggcaaggtgggcttccagagcttcttctcgctggtggccgggctcacc atcgcctgcaacgactacttcgtggtgcacatgaagcagaagggcaggaagtga

DBGET integrated database retrieval system