Alistipes dispar: A5CPEGH6_05890 Help Entry A5CPEGH6_05890    CDS       T06629                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ada  Alistipes dispar Pathway ada01100   Metabolic pathways ada01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ada00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A5CPEGH6_05890 (acpP)    00074 Mycolic acid biosynthesis     A5CPEGH6_05890 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A5CPEGH6_05890 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Guanylate_cyc DUF1493 Motif Other DBs NCBI-ProteinID:  BBL05951 UniProt:  A0A4Y1WY95 LinkDB All DBs Position complement(658234..658470) Genome browser AA seq 78 aa AA seqDB search MADVQSKVVEIIVDKLGVKESEVVPGASFTNHLGADSLDTVELIMEFEKAFDIQIPDEDA EKIATVGDAIKYIEEHKK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggcagatgttcaatcaaaagttgtcgagatcatcgtcgacaagctgggtgtcaaggag tcggaggtagtgcccggagcaagcttcaccaaccacctgggtgcggattcgctcgacacc gtggagctgatcatggagttcgagaaggctttcgacatccagattccggacgaggacgcc gagaagatcgctaccgtcggcgacgctatcaagtacatcgaggagcacaagaaataa

DBGET integrated database retrieval system