KEGG   Anopheles darlingi (American malaria mosquito): 125957270
Entry
125957270         CDS       T11379                                 
Name
(RefSeq) putative sodium-coupled neutral amino acid transporter 11
  KO
K14997  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 11
Organism
adar  Anopheles darlingi (American malaria mosquito)
Brite
KEGG Orthology (KO) [BR:adar00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:adar02000]
    125957270
Transporters [BR:adar02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   125957270
SSDB
Other DBs
NCBI-GeneID: 125957270
NCBI-ProteinID: XP_049545815
LinkDB
Position
3:complement(50227280..50250021)
AA seq 504 aa
MDTANNKKNTVSEFSYMLQRQGSDDSVEATAFDDINSLMKREDGANKPVETLSSLPQASF
NYINSIVGSGVIGIPYALHRAGFGLGLFLLVIVAVITDYSLILMVRCGHLSGRFSYPGVM
EAAYGKAGYYLLSLLQFMYPFLAMISYNVVVGDTLSKVLVRLVPSWGSSMGAVRFGVVLV
VTIFVVIPLCLYKNVSRLAKASFLSLACVVLILLAVVYRLLSGDYGVVPDTPESWRFAHT
DLIPAVGIMAFAFMCHHNTFLVYQSMQDATMERWERVTHISVGFAWLVAALFGIAGYCTF
RALSQGDLLENYCWDDDLMNFARVLFSVSILLTFPIECFVSREIVRTQVRRFYSHEAVES
YDTDADPSHVTGEEDDRQSMITTLLIVFAAFIISPYTECLGPVLELNGLLAAIPLAYVLP
GLAYIQLSPHSLFSQEKLPAAGLVLFGTIVTISGAAILMPNLIGDCRTGIIMGYCRDDEL
AMNGTASFAGVATTLAPNCVTDKV
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggataccgccaacaacaagaagaacaccgtgtccgagttcagctacatgctgcaacga
caaggcagtgacgattccgtcgaggcgaccgccttcgatgacatcaactcgttgatgaag
cgcgaggatggcgcgaacaaaccggtggaaacgctctcgtcgctaccgcaagcatccttc
aactacatcaactccatcgtgggcagtggcgtcatcgggatcccttacgccctgcaccgg
gccggcttcgggctcggtctctttctgctggtgatcgttgcggtcattaccgattactcg
ctcatcctgatggtacggtgcggtcacctgagcggacggttcagctatcccggtgtgatg
gaggcggcgtacggcaaggccggctactatctgctttcgttgctccaatttatgtaccca
tttctagccatgatctcgtacaacgttgtcgtcggtgatacgctgtcgaaggtgctggta
cgcctggtaccgtcctggggcagctcgatgggtgcggtccggttcggggtcgtcctggtc
gtgaccatcttcgtggtgataccgctctgtctgtacaagaacgtgtcccggctggcgaag
gcgagcttcctcagccttgcctgcgtcgtgctcatactgctggccgtcgtttaccggctc
ctgtccggggactacggtgtcgtcccggacacaccggaatcctggcggttcgcgcacacc
gatctcattcccgccgtcggtatcatggcgttcgcattcatgtgccatcacaacacgttc
ctggtgtaccagtcgatgcaggacgcgacgatggagcgctgggagagggtgacgcacatc
tcggttggattcgcctggctagtggcggccctgttcggtatcgccggttactgcaccttc
cgggcactgtcacaaggtgatctgctggagaactactgctgggatgacgatctgatgaac
tttgcgcgcgtcctgttctccgtgtccatcctactgaccttcccgatcgagtgtttcgta
tcgcgggagatcgtacggacgcaagtgcgtcggttttactcacacgaagccgtcgagtcg
tacgatacggatgcggatccgagccacgtcaccggcgaggaggacgatcggcaatcaatg
atcacgacgctgttgattgtgtttgccgcgttcatcatctccccgtacactgagtgtctt
ggtccggtgttggaattaaatggtctgctggcggccataccgttggcttacgtgctaccc
ggactggcctacatccagctcagtccccattcgctgtttagtcaggaaaagctaccagcg
gcggggttggtcctgttcggtacgatcgttaccatctcgggcgcggccattctaatgccg
aacctgattggcgattgccggacgggcatcatcatggggtactgtagggatgacgagcta
gcgatgaacggaacggcttccttcgccggagtggccaccactctggcgccgaactgtgtg
acggataaggtttaa

DBGET integrated database retrieval system